KEGG   Alteromonas macleodii Deep ecotype: MADE_1007595Help
Entry
MADE_1007595      CDS       T00747                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:amc00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1647166..1648071)
Genome map
AA seq 301 aa AA seqDB search
MNSSETKQKDWWPSPAKLNLFLHILGRYDNGYHQLQSLFQMLDYGDELAFDVTCSAASDT
DKERTEGNAPTIRMDIPLKGVPDDDNLIIKAARLLAQKTQCNKGAVISLNKRLPMGGGIG
GGSSNAATTLVALNHLWQTGLSEDELSALGLTLGADVPIFVRGLTAFAAGVGEDITPAPQ
QEHYFLVATPNVHISTADVFTSPDLPRNTPAIRWEDYEFEKTRNDCQQLVVNRYPEVAKL
LQWLVHYAPSRMTGTGASVFATFSDYTLAEQVRAKMPDTWQSFVAKGVNRSPLLDKLEQQ
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcatcagaaacaaaacaaaaagattggtggccttccccagcaaaactaaacctt
ttcctgcatatacttggccgatacgacaacggatatcatcagctacaaagcttgtttcaa
atgcttgattacggcgatgagctggcgtttgacgttacttgtagtgcggcaagtgacaca
gacaaagaacgtaccgagggaaatgcgccaaccattcgtatggatataccgttaaaaggt
gtaccggacgacgataatctcattatcaaggcggcccgattacttgcacagaaaacacaa
tgtaataaaggtgcggttatctcgttgaataagcgccttcctatgggcggtggcattggc
ggcgggtcgtctaatgctgctactaccttggttgcccttaatcacctgtggcaaaccggc
cttagtgaagatgaattgtcggcgttagggttaacgcttggcgctgacgttcccattttc
gtgcgtggtttaaccgcatttgccgctggcgtaggtgaagacattacccctgccccacaa
caggaacactactttttagttgcaacgcctaatgttcatatcagcactgctgacgttttc
acctcgccagatttgccgagaaatacaccggcaatacgttgggaagactacgaatttgaa
aaaactcgcaatgattgtcagcaattagtcgttaatcgctatcctgaagttgcaaaatta
ttacagtggttggtacactacgcaccgtcgcgaatgacgggcacaggtgcaagcgtgttt
gccactttttctgactatactttagccgaacaagttagggccaaaatgcctgatacttgg
cagagttttgtcgcaaaaggtgtaaatcgctcaccactattagacaaattagaacaacaa
agatag

DBGET integrated database retrieval system