KEGG   Alteromonas macleodii Deep ecotype: MADE_1009500Help
Entry
MADE_1009500      CDS       T00747                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:amc01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:amc00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:amc00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2144998..2146509
Genome map
AA seq 503 aa AA seqDB search
MTIEIKVPVLPESVADATIATWHVKAGDAVKRDQNLVDIETDKVVLEVVAPADGTIGEIL
NEEGATVLGEQVIAKLEKGGAAAASEPKAKSESKEESKEEATPAASGKASDVKVPVLPES
VADATIATWHVAVGEAVSRDQNLVDIETDKVVLEVVAPADGSLAEIIAEEGATVTAEEVI
AKFVEGAAGGASAPASSEESDDNDESSDALSPSVRRLLAEKGVDASKVKGTGKNGRITKE
DVEKYLKGGDSAQKSAPASTESAPAELPTGNRTEKRVPMTRLRKTIANRLLEAKNSTAML
TTFNEVNMKPIMDLRKQYQESFEKRHGIRLGFMSFYVKAVTEALKRFPEVNASIDGDDIV
YHNYFDVSIAVSTPRGLVTPVLKDTDTLGMAGVEKGIKELALKGRDGKLSLAELQGGNFT
ITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIIDGK
ESVGFLVTVKEMLEDPTRLLLDV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgagataaaagttccggttctacctgagtcagttgccgatgccaccattgca
acctggcacgttaaggccggtgacgcagttaaacgagaccagaacctggttgatattgaa
actgataaagtggttttagaagttgtggcgccagcggacggtacaattggtgagatccta
aacgaagagggtgcaacagttttaggcgagcaagtaatcgcaaagctagagaagggcggc
gcagctgcagcttctgagccgaaagctaagagtgagtctaaagaagagtctaaagaagaa
gctactccagcggcttctggcaaagcatctgacgtgaaagtacctgttcttccagaatct
gttgctgatgcaactattgctacttggcatgttgcggtaggcgaagcggtgtctcgtgac
caaaacttggttgacattgaaactgacaaggtcgtacttgaagtggtagcgcctgcagat
ggttctcttgcagaaatcatcgctgaagaaggtgcaacagtaacagctgaagaagttatt
gccaagtttgttgaaggcgctgcaggcggtgcatcagcaccagcgtcttcagaagagagt
gatgacaacgacgaaagcagcgatgcgcttagcccatctgtacgtcgtctcctagctgag
aaaggcgtagatgcgtctaaagttaagggtacgggcaaaaatggccgtatcactaaagag
gacgttgaaaagtatcttaaaggtggtgacagtgctcaaaaatcagcgcctgcatcaact
gagtcagcgccagcggaattgccaacgggtaaccgtacagagaagcgtgtacctatgacg
cgtcttcgtaaaacaattgctaatcgtcttcttgaagcgaagaactcaacggcaatgttg
actacgtttaacgaagtcaacatgaagcctattatggaccttcgtaagcagtatcaagaa
agcttcgagaagcgtcacggtattcgtcttggctttatgtctttctacgtgaaagccgta
actgaagcgcttaagcgttttcctgaagttaatgcgtctatcgacggtgatgacatcgtt
tatcacaactatttcgatgtatcgattgctgtttctacaccgcgtggccttgtgacacca
gtacttaaagatactgacacactgggtatggcgggtgttgaaaaaggaattaaggaacta
gcacttaaaggccgtgacggtaagctgtcactcgctgaactacaaggtggtaatttcaca
atcaccaacggtggtgtgtttggttcactaatgtctacaccaatcattaacccgccacaa
agcgcaattcttggtatgcacaaaatccaagatcgcccaatggcagttaatggcaaagta
gaaattctaccaatgatgtacctagcgctttcttatgaccaccgtattatcgatggtaaa
gaatcggtagggttcttggtaaccgttaaagagatgctagaagatccaacacgtctatta
ctagacgtttaa

DBGET integrated database retrieval system