KEGG   Alteromonas macleodii Deep ecotype: MADE_1009720Help
Entry
MADE_1009720      CDS       T00747                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MADE_1009720
   01230 Biosynthesis of amino acids
    MADE_1009720
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MADE_1009720
   00030 Pentose phosphate pathway
    MADE_1009720
   00051 Fructose and mannose metabolism
    MADE_1009720
   00052 Galactose metabolism
    MADE_1009720
  Energy metabolism
   00680 Methane metabolism
    MADE_1009720
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MADE_1009720
Enzymes [BR:amc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MADE_1009720
Protein phosphatases and associated proteins [BR:amc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MADE_1009720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2204698..2205792)
Genome map
AA seq 364 aa AA seqDB search
MLHYKRPLYVAYPLLYLNRIACKKKDFNVSKRVAILTSGGDAPGMNACIRATIIACQKAG
YTLLGYKHGYNGLLQQEYISLSLDSTHNLIQQGGTILHSARCKEFMHEEGLLKAAHNLKK
ARIDSLIVIGGDGSFKGAAKLSEHWDGQIIGIPGTIDNDIAGTDATIGYFTAIDTAMSSI
DKVRDTADAFERIFLVEVMGRNAGFLALNAALSSAADYVIVPEFFSSAESEIEKLVSQIN
AQRTLKGPVSFIVVVAENVWPNGLAGLTDALQQRNLQDVRPVTLGHVQRGGSPVAQDRLL
ATTLGEAAIRLVGKDISNVMVGEVNQRPVTVPLSETWKNTKPLNEARVGAMRTLMNERYN
QADN
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcttcattacaaacgtccactttacgtagcgtaccctttactttaccttaaccgtatt
gcctgtaaaaagaaggactttaatgtgtcaaaacgtgtcgcaattttaacatctggtggc
gacgcaccaggtatgaatgcatgtattcgggccactatcattgcctgtcaaaaagccggt
tatacactgttgggctataagcatgggtacaatgggctactgcagcaagaatatatttca
ttgtccttagactctacgcataaccttattcagcaaggcggtacaattttacatagcgca
aggtgcaaagagtttatgcacgaagaggggctgttaaaagcagctcataatttaaagaaa
gcgcgcatagattcattaattgttatcggcggcgacggctcgtttaaaggggctgctaaa
ttaagcgagcattgggatgggcaaattataggtatccctggcactatcgataacgacatt
gcgggaacagacgcaactatcggttatttcacggctattgatacggccatgagctctatc
gataaagtacgcgatactgccgacgcttttgaacgtatctttttagttgaggtaatgggg
cgcaatgctggcttcttagcccttaatgctgccctctcctctgctgcagactatgttatt
gttccagaatttttctcttcagctgaatctgaaatagaaaaactcgtgtcacaaatcaac
gctcagcgaacgctgaaaggccctgttagttttattgttgtggttgcagagaacgtatgg
cccaacggactagcgggcttaactgatgcccttcaacaacgaaatctacaagatgtaagg
ccggttactttaggtcacgttcagcgcggtggttccccggtagcgcaagaccgactttta
gcgactacgctcggagaagcggccattcgattggtgggaaaagacataagtaatgttatg
gttggtgaggttaatcagcgtccagttaccgtgccattgtctgaaacgtggaaaaatact
aaaccgcttaacgaggcccgtgtcggcgccatgcgaacgcttatgaacgagcgttataac
caagcagataactag

DBGET integrated database retrieval system