KEGG   Alteromonas macleodii Deep ecotype: MADE_1010935Help
Entry
MADE_1010935      CDS       T00747                                 

Definition
alpha-amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MADE_1010935
Enzymes [BR:amc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     MADE_1010935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2437777..2439531
Genome map
AA seq 584 aa AA seqDB search
MAWEHLHDKVKHHLESIYADVALDVSYETLATELMNTIGIQQQTDIASPQSHHNYWDEED
IIMITYGDSVIDEDERPLVTLNKFMHRYCKNTINNVHILPFFPYSSDDGFSVIDYSTVNE
ALGSWDDIEAIAKDYGLMTDLVINHCSARSVWFDNFVKGEGPGSDFFFTADPADDLSLVT
RPRVSPLLRETETADGTKYVWCTFSHDQVDFDFRNPKVLLAFIDIIKLYIDKGAKIFRLD
AVAFLWKIVGTNSINLFQTHEVIRLIRTLIEHVDPSIIIITETNIPNRENLTYFGNANEA
HAIYNFSLPPLLVNTLVSGDCTYLKSWMMSMPPAQNGTAYFNFIASHDGIGLRPAEGLLS
EEEISDLVHAMQHFGGKVSWRASEHGQQKPYEINITLFDALQGTIKGPDKYQVDRFICAH
AIMLGMEGIPGIYIHSLLGTSNDYEKVANTGQNRSINRKRWDFNELEALLDSPFSQHHKV
LTRISQLIRIRKAQPAFHPNATQFTLQLGNQIFGYWRQSLDRKQSIFCISNICDEEQTIL
LSDINLIGTDNWIDLITRDEISLSSGFLQMKPYQVLWISNQDFE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggagcacctccatgacaaagtaaagcaccatttagaaagcatttacgccgat
gtagcgctagacgtctcttatgagacgctagccacagagctaatgaatacaataggtatt
cagcaacaaacagatatagcttcacctcaatctcatcacaactattgggatgaagaagac
attatcatgatcacctatggtgatagcgtgattgatgaagatgagcgccctcttgttacg
ttgaataagttcatgcatcgttattgtaagaacacaatcaataacgtgcatattcttccc
ttctttccttatagttccgatgacgggttttctgtcatcgactactctacggtaaacgaa
gcattaggatcgtgggatgatatcgaagctatagccaaagattatggcttgatgacagac
ttagtgataaaccactgctctgcgcggagcgtttggttcgacaactttgttaaaggtgaa
gggccgggatctgactttttctttaccgcagatccggctgacgatttatcgctggtgacc
cgccctcgtgtttcccctttgttgcgtgaaaccgagaccgccgatggcactaagtatgtg
tggtgtaccttcagtcacgatcaagtagactttgactttagaaaccccaaagtgctttta
gcgtttatcgatatcattaaactgtacattgataaaggcgccaagatattccgtttagac
gcggttgcctttctatggaaaattgtgggcacaaacagcattaatctgtttcaaactcac
gaagtcattcgtttaataagaaccctgattgaacacgttgacccatccatcattatcatt
accgaaacaaatattccaaacagggaaaatctaacctattttggtaatgcaaatgaagcc
catgcaatctataacttttcgttaccgccactgcttgtaaacacattggtaagtggtgat
tgtacttatttgaagagttggatgatgagcatgcctcctgcacaaaacggcacggcatac
tttaactttattgcttcgcacgatggtattgggctgcgccctgcagaaggcctgctttct
gaagaagaaatatctgatttggttcacgccatgcagcacttcggtggaaaagtatcttgg
cgggcctctgagcatggtcagcaaaaaccgtatgaaattaacatcacactgtttgacgct
ctgcaaggcacgataaaggggcctgacaagtatcaggtcgaccgttttatttgtgcacat
gccattatgttaggcatggaaggtattcctggtatctatattcatagtttactgggcacc
tctaacgactatgagaaagtcgctaacactggccagaaccgctcgataaacagaaagcgc
tgggactttaacgagctagaagccttgttagattctcctttctctcagcatcacaaggtt
ttaactcgtatatctcagttaatccgcatacgtaaagctcagcctgcattccaccctaat
gctacgcagtttacgctgcaattgggcaatcaaatattcggctattggcgtcagagctta
gacagaaagcaaagtattttctgtatcagcaatatttgtgacgaagagcaaactattttg
ctttctgacattaacttgataggtacagacaactggattgacctcattacccgtgatgag
atttcactttccagcggctttttacaaatgaagccctaccaagtactgtggatcagtaac
caagattttgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system