KEGG   Alteromonas macleodii Deep ecotype: MADE_1011665Help
Entry
MADE_1011665      CDS       T00747                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2612037..2614229)
Genome map
AA seq 730 aa AA seqDB search
MHLAQQFEQVTCSQPFSHLGVIASQQGAMLRVWCPDASEVTIKWENSALADRVIKSDNAN
GLFEASLPAEYNGEIYRVVANKGRGDNGYIDPYQFTEQAYHAVHYIDSTPANLYEQAGAQ
LIDISTPQGKTVSGVRFCVFAPNASAVSLIGDFNQWDGRTHPMEKTSMGYWVLFVPELTE
GERYKYHIKDANGHDLPHKADPLGFCAEQYPSHASKIYNHRSYQWSDSDWMENRKGDKYA
SPMSIYEVHLGSWKRPDAATEARYLTYKELADDLIGYVSDMGYTHVELLPISEFPFDGSW
GYQPVGMFAPTSRFGNPDDFKYFVDKCHQAGVGVIIDWVPAHFPEDGHGLARFDGSCVYE
YEDPRKGWHPDWNSCIYDFGKDTVRQFLVANALYWLDKFHVDGLRVDAVASMLYLDYSRN
EGEWIPNVDGGNENYEAISLLKWMNEEVYKHFPDAMTIAEESTSFPKVSRPVFDGGLGFG
FKWNMGWMHDSLHYIAKDPAYRNYHHGDITFSMVYAFDENFVLPISHDEVVHGKGSMLHK
MPGDEWQQAANLRCYAGFMYGHPGKKLNFMGNELAQAREWNHDSSLDWHLLDFEKHAGIQ
ALYKALNHLYTSTPALYEQDHDPAGFAWLDHSNADQSVVSFVRTSKDAKQKVYVVSNFTP
VPRKNFRIGVDEACTLTLALNTDDGVYWGSNYEVVANTTAQLVPWNDRRHSVEITLPPLA
TVFYVADLSE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgcatttagcgcagcagttcgaacaagtaacatgttcccaaccattttctcatcttggc
gtcattgccagtcaacaaggtgcaatgcttcgtgtttggtgtcctgacgccagcgaagta
acgattaaatgggagaattctgcgctagctgatcgagttattaaatcggacaatgcgaat
ggcttatttgaagcgtcacttcccgctgagtacaacggtgaaatttaccgcgtagtcgct
aataaggggagaggggataatggttatatcgacccttatcaatttactgaacaggcttac
catgccgtacattatatcgatagcacgccagcaaatttgtacgaacaagcgggtgcgcag
ttaattgatatctctacaccacagggcaagacggtaagtggcgtgaggttttgtgtattt
gcgccaaatgcaagcgcggtatcactcattggcgatttcaaccagtgggacggacgtact
cacccgatggagaaaacgtcgatggggtattgggtgctcttcgtacccgagctcactgaa
ggcgaacgctataaatatcatatcaaagacgccaatggtcatgatttaccgcataaagct
gaccccttaggattctgtgctgagcagtatccttctcatgcgtcgaaaatttataatcac
cgttcctaccagtggagcgatagtgattggatggaaaatcgcaagggggataaatacgcc
agccctatgagcatttatgaggttcacttaggctcatggaaacgacctgacgctgctaca
gaggcgcggtatcttacctataaagaacttgccgatgatttgattggttacgttagcgat
atgggctacacccatgtggaactgctaccaatatcagagtttcctttcgacggctcgtgg
ggataccaaccggtaggtatgttcgcgcctaccagtcggtttggcaatccagatgacttc
aaatactttgtcgataaatgtcaccaagccggcgtgggcgttatcatcgattgggtacct
gctcattttcctgaagatggacacggtctggcaaggtttgacggttcgtgtgtgtatgaa
tatgaagaccctcgtaaaggctggcacccagattggaactcatgtatctatgactttggc
aaagataccgttcgtcaatttttagttgccaatgctctttactggcttgacaagtttcac
gtggacggacttcgggttgatgcggtagcgtctatgctttatttagattactcccgcaac
gaaggcgagtggatcccgaacgttgacggcggtaatgaaaattacgaagcgataagcctg
cttaaatggatgaacgaggaagtatacaagcacttcccagacgctatgactatagcggaa
gagtccacgtcatttcccaaagtatctcgccctgttttcgacggtggcttaggctttggc
tttaaatggaacatgggctggatgcacgactcgctgcactacattgcaaaagaccctgca
tatcggaattaccaccacggtgatatcacgtttagcatggtttatgcctttgatgaaaat
tttgttttacccatttcccatgatgaagtcgtacatggtaaaggcagcatgctacataag
atgccgggcgatgagtggcaacaagccgctaatttgcgctgttacgcaggtttcatgtat
ggccatccaggcaagaagcttaacttcatgggtaacgaactggcgcaagcacgggaatgg
aatcacgatagcagcttagactggcacttgcttgacttcgaaaagcacgcaggtatccaa
gcgctgtataaggcgttaaaccatttgtacacctccaccccagccctttatgaacaagat
catgacccggcgggttttgcgtggcttgatcacagcaatgcggatcaaagcgttgtgtcg
tttgttcgcacttcaaaagatgcaaagcaaaaagtctacgtggtgtctaactttacgcct
gtcccgcgcaagaactttagaattggtgtggatgaagcctgcacgttgacgctggcgctg
aacaccgacgatggggtttattggggtagcaactacgaagtcgttgccaacacaaccgca
caacttgttccgtggaatgatcgtagacattcagtagagataaccttaccgccacttgct
acggtgttttacgttgctgatttgagtgaataa

DBGET integrated database retrieval system