KEGG   Alteromonas macleodii Deep ecotype: MADE_1011670Help
Entry
MADE_1011670      CDS       T00747                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MADE_1011670
Enzymes [BR:amc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MADE_1011670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2614392..2616590)
Genome map
AA seq 732 aa AA seqDB search
MTQQLLQQLVEMRGIETQYVDAWGKPATIAESSKAKLLNTLGYDTSSDEKIQSQITQDIK
SVWLSPLNPVQVVRNTQEINLAVRLPIELVNDVHTLTVTCEAGNVLTHDFTPVDQEMTTM
AHIDDVEFHEYVVTLPLDLPLGYHDVALSADDDEFARSRIIVAPEACYTPNEIKEGKKIW
GLSVQLYCVRSENNWGIGDFSDLSQLIEKAAGVGADFIGLNPIHALYPANPNACSPYGPS
SRRWLNYLYIDVTSIEGYDDTSVQTIVNDDEFTATLEHARNVEHVNYEAVAHIKLAALKA
VFEVYEAKYLRKNTKQNKAFKAFVEAGGESLDMLAVYDALQSHLKGEGKESWGWPVFPEE
FKDYHNPAVAKFKRANEHEVKFYLFLQWIAAQQLEQASNKASDAGMTIGLYRDLAVGVSE
GSAEIWGNKDLYCTDASVGAPPDILGPLGQNWGLPPMDPHKLYEQGYQPIIDLFASNMAS
SGSLRIDHVMALLRLWWVVKGDDAKEGGYVYYPVDDLLGILALESHRNQSLVIGEDLGTV
PEEIRSKLAENGVYSYRVFFFEQAEDGGFFSPSHYPVQSMSTLTTHDMPTLIGYWHCLDL
ELGKEIGLYPTEEILQILYTDRHKNKQAILDTLHGHGSISDSISHNVNFTGMNRELNNGM
QVHMAGGSSALLSLQLEDWLEMDKPVNIPGTFDEYPNWRRKLTENIESMFERHDINELAS
KLTHARKQASQG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaacttctgcaacaactggttgaaatgcggggaatagaaacccaatacgta
gacgcatggggaaaaccagcaaccatcgcagaatcaagcaaagcgaaattgctcaataca
cttggctatgacaccagcagtgacgaaaaaattcagtcacaaattacacaagatataaag
tcggtgtggttgtcgccactaaatcctgttcaggtggtgcgcaacactcaagagatcaat
ctagccgtgcgcttacctattgagttggtaaacgatgtacacaccctaactgttacctgt
gaagcgggtaacgtacttactcatgacttcacgccggttgaccaagaaatgacaaccatg
gcgcacattgatgatgttgaatttcatgaatacgttgtaacgctacctttagatttgccg
ttgggatatcacgatgtcgcactaagtgccgatgacgatgaatttgcccgctctcgcatt
attgttgcaccagaagcctgctacacgccgaatgaaattaaagaaggcaagaaaatatgg
ggcctaagcgtacagttatattgtgtgcgtagtgaaaataactgggggattggtgacttc
tcggacctttctcaacttattgaaaaagcagcgggcgttggagcagactttattggctta
aatcctattcacgccttatacccagcgaacccaaatgcatgctctccttatggtccaagt
tctcgccgctggttaaattacctgtacatcgacgttacgtcgattgaaggctacgacgac
acatcagtgcaaacaatagtgaacgatgacgagtttaccgctactttagagcatgcgcgc
aatgtagagcatgtgaactacgaagccgtagcacatattaagttagccgcgcttaaggct
gtatttgaagtgtatgaagccaaataccttcgtaagaacacaaagcaaaacaaagcattc
aaagcgtttgttgaagcaggcggtgaaagtttagatatgcttgcggtgtatgatgcgctg
caatctcaccttaagggtgaggggaaagaaagttgggggtggcctgtattcccagaagag
tttaaagattatcacaatccagccgtcgctaaatttaagcgcgccaacgaacacgaagtg
aaattttacttgttcttacaatggattgctgcgcaacagctagagcaggcgagcaacaaa
gccagtgatgctggcatgaccattggcttgtatcgcgacctagcggtaggtgttagcgag
ggaagcgcggagatttggggcaataaagacctttactgtactgatgccagtgtaggcgcg
ccaccagatattttaggcccccttggtcaaaactggggtcttccaccaatggacccgcac
aaattatatgaacaaggctatcagcccattatcgacttatttgcttctaacatggcgtca
tcaggttcgctacgaatcgaccacgtaatggcgcttctgcgattatggtgggtcgttaag
ggtgacgatgcaaaagaaggcggttatgtttactatccggtagatgatttgttaggcatt
cttgcgctagaaagtcatcgtaaccaaagccttgtaattggcgaggacctaggcacagta
cctgaagagattcgcagtaagcttgctgaaaatggcgtgtattcgtatcgcgttttcttc
tttgagcaagccgaagacggcggtttcttctcgccaagtcactatccggttcagtcgatg
tcgacgttaaccactcacgatatgcccacacttatcgggtactggcattgtttagattta
gaattaggcaaagagattgggctgtatccaacagaagaaatcctgcaaatcttgtataca
gaccgtcacaaaaataagcaggctattctagataccttgcacgggcatggttcaattagc
gatagtatcagtcacaatgttaattttacgggtatgaaccgtgaattaaacaacggaatg
caggtacacatggcagggggctctagtgctctgctcagtcttcaattagaagactggctg
gaaatggacaagccagttaatatccctggtacttttgacgaatatcctaactggcgtaga
aagctgacagagaatatcgagtcgatgttcgaaagacatgatataaacgaattagcatct
aaacttactcatgcaagaaagcaagccagccaaggttaa

DBGET integrated database retrieval system