KEGG   Alteromonas macleodii Deep ecotype: MADE_1011690Help
Entry
MADE_1011690      CDS       T00747                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MADE_1011690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MADE_1011690
   00052 Galactose metabolism
    MADE_1011690
   00500 Starch and sucrose metabolism
    MADE_1011690
   00520 Amino sugar and nucleotide sugar metabolism
    MADE_1011690
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MADE_1011690
   00524 Butirosin and neomycin biosynthesis
    MADE_1011690
Enzymes [BR:amc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MADE_1011690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2619690..2620643)
Genome map
AA seq 317 aa AA seqDB search
MSQKFVADVGGTNIRVARVTDSGVADIKKYMCNDFASIDLAIGQYFADMPQYNFTQGCIA
IACPVLGDQVEMTNHSWAFSQNALRTQLKLDALFVINDFTAVAHSLPVLGEDQVVQIGEG
IAKENGNIAVFGPGTGLGVEHITMTSSGWQTLDGEGGHVDFAPVDETDVVVWRHLQTTLG
RASAEEVMSGRGLHNIYTALANDASAPVAFTEPAQITEAALNGTCKIAEATLTQFCRIMG
SFAGNLALNMATTGGIFIGGGIANRFPEFIQNSDFRARFEAKGQMKHYVKDIPTFLIAEP
DHGLLGAAAYLNQNTAS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaagtttgtggctgatgttggcggaacgaacattcgtgttgcgagagtaacc
gactcaggtgtcgctgacattaaaaaatacatgtgtaacgactttgccagcattgattta
gctataggacaatactttgctgacatgccgcaatacaactttactcaaggttgtattgcc
atagcttgtccggtacttggcgatcaggtcgaaatgaccaatcacagctgggcattttca
caaaatgccttgcgcactcagcttaagttagacgcattatttgtgataaacgactttact
gcggtagcgcactccttgcctgtattaggcgaagaccaagtcgttcaaattggtgaaggc
atagcgaaagaaaatggcaatattgctgttttcgggcctgggacgggattaggtgttgag
cacatcaccatgacctcgtcaggctggcaaaccctggatggtgagggcggtcatgtcgat
tttgctcccgttgatgagactgatgtagtggtatggcgtcatctacaaacaacattaggc
cgagcgtctgctgaagaagtcatgtctggccgtggtttacacaacatctataccgcgtta
gctaacgatgcgtctgcaccggtagcatttactgagccagcgcaaatcaccgaagctgca
ctaaacggaacctgcaagatagcagaagccactttaacgcagttctgtcgcataatggga
agctttgcaggtaatctagcccttaatatggcgacaacaggcggtatcttcattggtggt
ggcattgccaaccgtttccctgagtttattcaaaacagtgactttagagcgcgttttgaa
gcaaaggggcaaatgaagcattacgtgaaagacattcccacctttttaattgcagagcct
gatcatggtctattaggtgcggctgcatatctgaatcaaaatacagcgagctaa

DBGET integrated database retrieval system