KEGG   Alteromonas mediterranea DE: MADE_1012105Help
Entry
MADE_1012105      CDS       T00747                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00071  Fatty acid degradation
amc00280  Valine, leucine and isoleucine degradation
amc00281  Geraniol degradation
amc00310  Lysine degradation
amc00360  Phenylalanine metabolism
amc00362  Benzoate degradation
amc00380  Tryptophan metabolism
amc00410  beta-Alanine metabolism
amc00627  Aminobenzoate degradation
amc00640  Propanoate metabolism
amc00650  Butanoate metabolism
amc00903  Limonene and pinene degradation
amc00930  Caprolactam degradation
amc01100  Metabolic pathways
amc01110  Biosynthesis of secondary metabolites
amc01120  Microbial metabolism in diverse environments
amc01130  Biosynthesis of antibiotics
amc01212  Fatty acid metabolism
Module
amc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MADE_1012105
   00650 Butanoate metabolism
    MADE_1012105
  Lipid metabolism
   00071 Fatty acid degradation
    MADE_1012105
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MADE_1012105
   00310 Lysine degradation
    MADE_1012105
   00360 Phenylalanine metabolism
    MADE_1012105
   00380 Tryptophan metabolism
    MADE_1012105
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MADE_1012105
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MADE_1012105
   00281 Geraniol degradation
    MADE_1012105
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MADE_1012105
   00627 Aminobenzoate degradation
    MADE_1012105
   00930 Caprolactam degradation
    MADE_1012105
Enzymes [BR:amc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MADE_1012105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 DUF1139
Motif
Other DBs
NCBI-ProteinID: AEA98557
UniProt: F2G639
Position
complement(2756000..2756839)
Genome map
AA seq 279 aa AA seqDB search
MKYSTLEIKQEGHIAHVVLNRPDAMNSMIPEFWTELPAAIREIDDEANARVIVISSTGKH
FSAGMDLSVFLNMKEDFKGDPSRRAERMRRMVMLLQDSFTAIEQARMPVIGAVQGGAIGG
AVDLLSACDMRYCTQDAFFTIKETQLGMTADVGTLQRLPKLIPIGVVKELAYTGRNFGAA
EAQQLGFVNKVFDDQASMLEAVMKIAQQIAMNSPLAVSGTKTMINYAVEHTVAESLTYMA
TWQAGMFQMEDVFKAMEAQKTKTLPEYPPLHPAIKKMNS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagtactctacattagaaataaaacaagagggccatattgcccacgtagtacttaac
cgcccagatgcaatgaacagcatgatccctgaattttggacagagctgccagcggctatt
cgtgaaatagatgatgaagccaatgcccgcgttattgttatttcatctacaggaaagcat
ttctctgccggtatggatttatcggtgtttctgaacatgaaagaagattttaagggcgac
ccatcgcgcagagcagaacgcatgcgccgtatggttatgctgctacaagatagctttacc
gccattgaacaggcacgtatgccggttattggggcggttcaaggtggcgctatcggtggt
gcggtagatttgcttagtgcgtgcgacatgcgttattgcactcaagatgcgtttttcacc
ataaaagaaacccagttaggcatgacggcggacgtaggcacccttcagcgactgcctaag
cttattcctattggtgttgtgaaagagctggcttacaccgggcgtaactttggtgccgca
gaagcgcagcaactcggttttgtaaataaagtttttgacgaccaggcttcaatgctagaa
gccgtaatgaaaatagctcagcagattgcgatgaattcgccactagcggtttcaggcacc
aagacgatgattaattacgcagtcgaacatacggtagctgaaagcttaacgtacatggcc
acatggcaagcgggaatgttccaaatggaagatgtgtttaaagctatggaagcacagaaa
acaaaaacgttgccggagtacccgccattgcatcccgctatcaaaaaaatgaattcatag

DBGET integrated database retrieval system