KEGG   Alteromonas mediterranea DE: MADE_1012320Help
Entry
MADE_1012320      CDS       T00747                                 

Definition
(GenBank) 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase
  KO
K01814  
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
Organism
amc  Alteromonas mediterranea DE
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MADE_1012320
Enzymes [BR:amc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     MADE_1012320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2802268..2803005
Genome map
AA seq 245 aa AA seqDB search
MIIPAIDLIDGHVVRLYQGDYEQKTQYELDPVEVVHDYADQGATWLHIVDLTGAKDTSKR
QLELIKSMVDTKRMQFQAGGGIRSEEEVAQLLETGVSRVVIGSLAVKQPELVKSWVEKYG
PERIVLALDININESGEKLIATHGWQENSGVALEGLLEDFATVGAKHVLCTDISRDGTLQ
GANTELYQEMAARFPNVSWQASGGIGSINDIEALKPTNVGGVILGRALLEGKFTVKEAIA
CWQSA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgattattccagcgatagatcttattgacggacacgtagtacgcttatatcaaggtgac
tacgagcaaaaaacccaatacgaactggaccctgtagaagtggttcacgactatgccgac
caaggcgcaacctggctacacattgttgaccttactggcgctaaagacaccagcaaacgt
cagctagagttgattaaatccatggtggataccaagcgcatgcagtttcaagccggcggc
ggtattcgcagtgaagaagaagttgcgcagctgcttgaaaccggtgtgagccgcgtagta
attggctcgctagcggtaaaacagccagaacttgtaaagtcttgggtagagaaatatggc
cctgagcgcattgtgctggcccttgatatcaatattaacgaaagcggtgaaaagcttatt
gcgacgcacggctggcaggaaaactcaggcgtagcccttgaaggcttgcttgaagacttc
gctacagtgggcgcaaagcatgtgctatgtactgacattagccgcgacggtacgctacaa
ggcgcgaacacagagttataccaagagatggcggcacgttttcctaatgtaagctggcaa
gcttctggtggtattggcagcattaacgacatcgaagcacttaagcccactaacgttggt
ggcgtaattttaggtcgcgccttacttgaaggtaagtttaccgtgaaggaggctatcgca
tgctggcaaagcgcataa

DBGET integrated database retrieval system