KEGG   Alteromonas macleodii Deep ecotype: MADE_1013045Help
Entry
MADE_1013045      CDS       T00747                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amc00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:amc00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:amc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3006105..3007571)
Genome map
AA seq 488 aa AA seqDB search
MIKQFVRTSILSCASIAVLAGCGITESAHQPANHNRAQLQGVPKNIIMVVADGMGPAYTT
AYRNYVDDPTTPNIEPVVFDDILVGNASTYPAQVSGYVTDSAAAATALASGVKSYNGAIG
VDVNKQPVNSVMYYAKSKSMRTGLAVTSQIVHATPASYIAHNESRKNYNEIADDFFDVRV
NGEFVADVMLGGGTSYFEREDRDILAQFIDAGYEYADSYNRLASVPAGSNVLGLFAPVAL
PAVLDDKRKNRLKYLTKNAIKHLENDNGFFLLVEASQVDWAGHANDIASAMAEMHDLAIT
MEYLRDYVEANPDTLVVLTADHSTGGLTIGANGDYRWSPEHLKSLSASVMTIALEMANEE
NPGEFVAAKLGLSLTEQELATLNSISNQDDKTRLSAVKTFLDTKTNTGWTTGGHTGVDVE
VFAFGAGYQSFMGQIDNTDIAKKIFSFIDKKQPAKIAFPSKKVSTNIELTSDEDDDELCD
FKEDWRCN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacaatttgttcgcacatccattctaagctgtgcgtctatcgccgttctagcg
ggttgtggtatcactgaatccgcacaccagccagccaatcacaatcgcgcccagctacag
ggcgtgccaaagaatatcattatggttgtggcagatggtatgggcccggcctacacaacg
gcatatcgaaactatgttgacgacccaactacaccaaacatagagcccgtagtgtttgat
gacattttagtcggaaatgcatccacgtatccggctcaagtgtctggttatgttaccgat
tcggctgcagcagcaacagcactggcttcgggtgtgaaatcatataatggcgctataggc
gtagatgtaaacaaacaacctgttaattcggttatgtactatgcgaaaagcaagagcatg
cgaacgggtcttgcagtaacgtctcaaattgttcatgccacgccggcttcgtatattgct
cataatgaaagccgcaaaaactataatgagattgctgacgacttttttgatgtgcgcgta
aacggtgagtttgtcgcagatgtaatgttaggtggtggtacgtcttattttgagagagaa
gatcgcgatattttggctcagtttatcgacgcaggctatgaatatgctgattcatataat
cgcctagcttctgtgcctgccggtagtaatgttttgggcttatttgccccagtggcgttg
cccgctgttctcgacgataagcgtaagaaccgtcttaagtatctaacaaaaaatgccatt
aaacatttagaaaatgataacggcttcttcctattagttgaagcaagccaagtagactgg
gcaggacacgctaacgatattgcttctgctatggctgaaatgcatgatcttgctattacc
atggagtatttgcgtgactatgtagaagcgaacccagacaccttggtggtattgacggct
gatcatagtaccggcggtttgaccattggcgcgaatggcgactatcgctggagcccggag
caccttaaatcgctttctgcatcggtaatgacaattgcacttgaaatggcaaacgaagaa
aaccctggcgaattcgtcgccgctaaattaggcctgtcactaaccgaacaagagttagct
acgttaaatagcatatcgaaccaggacgacaaaacgcgcttgagtgctgttaaaacgttt
cttgacaccaagacaaacacaggctggaccacaggcggtcacacaggcgtagatgttgaa
gtgtttgcctttggcgcgggttatcagtcgtttatggggcaaattgacaacacagatatt
gcgaagaaaatttttagctttattgataaaaaacaacccgcaaaaatcgcttttccgtca
aagaaagtatcaactaacattgagcttacttcagatgaagatgacgacgagctttgtgac
tttaaagaagactggcgctgtaattaa

DBGET integrated database retrieval system