KEGG   Alteromonas macleodii Deep ecotype: MADE_1013055Help
Entry
MADE_1013055      CDS       T00747                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MADE_1013055
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MADE_1013055
Enzymes [BR:amc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MADE_1013055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3009115..3010710
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQKGTWEGINPEFAARMKVQNRFKTGLDIARYTAGIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTSKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDDGVIVARTDSLGAGLTQKIPVSTSEGDLAAQYNAFLKTTEVAGADDLSE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWTEEGKDVSGYDRAKLMSADYDD
SELAAEADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccaccttaaaggcagcacagaaagga
acgtgggaaggtataaacccagagttcgctgctcgcatgaaagttcaaaatcgtttcaaa
actggcttagacattgcccgttatactgcaggcatcatgcgtaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcactaggctgctggcatggctttgtaggccag
caaaaaatgctttcagttaaaaagcaccaaggtacaaccagcaaaagctacctttaccta
tctggttggatggtagcggcgcttcgctctgaatttggtccgctacctgaccaatcaatg
cacgaaaaaacgtcagtttctgcccttatcgaagagctttacaccttccttcgccaggca
gatgcccgtgaattaggcgaccttttccacaaactagacgacgcgaagaaaaacggcggc
gatgtagcggctatccaagctgaaatcgacaactacgaaactcacgtagtaccaattatt
gcggatatcgacgcaggttttggtaacgaagaagcaacttatctacttgcaaaacaaatg
attgaagcaggtgcatgctgtatccaaatcgaaaaccaagtgtcagatgcgaagcaatgt
ggtcaccaagacggtaaagtaaccgtgccacacgaagacttcctcgcaaaaatcaacgct
gtacgctatgcattccttgaactcggtgttgacgacggcgttattgttgcacgtactgac
tcactaggtgctggtctgactcaaaagatcccagtgtctacctctgaaggcgacctggct
gcacaatacaacgcattccttaaaaccacagaggttgctggcgcagacgacctatctgaa
ggcgacttagtattaaagcaaggtggcaagcttgttaagccagagcgtttgccaaacggt
ttgttccgctttaaagacaacacaggttttgaccgcgtagtacttgactgtgttacgtcg
ctcaagcacggtgctgacctactttggattgagactgaaaagcctcacgttggtcaaatt
gctgaaatggttaacgctattcgcgagcaagtaccaaacgctaagctggtatacaacaac
tctccatcgtttaactggacacttaacttccgtcagcaagtatttgatgcttggacagaa
gaaggtaaagatgtgtcgggttacgaccgtgcgaagcttatgtcagcagattacgatgat
agcgaacttgcagcagaagctgatgagaagattaagagcttccaagctgacgcagcacgt
gaagccggtatcttccaccaccttatcacgctacctacttaccacactgcagcactgtct
actgacaaccttgcgaaaggctacttcggtgaagaaggtatgcttgcttatgtacgcggt
gttcagcgtcaagaaattcgccaaggccttgcgtgtgttaaacaccaagcgatggcaggt
tctgacctaggtgatacgcacaaagagtacttctctggtgaaggtgcacttaaagcgtct
ggtgaagataacaccatgaatcagtttgacgtataa

DBGET integrated database retrieval system