KEGG   Alteromonas macleodii Deep ecotype: MADE_1013055Help
Entry
MADE_1013055      CDS       T00747                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:amc01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3009115..3010710
Genome map
AA seq 531 aa AA seqDB search
MSQYQQDIDNFATLKAAQKGTWEGINPEFAARMKVQNRFKTGLDIARYTAGIMRKDMAEY
DADSSQYTQSLGCWHGFVGQQKMLSVKKHQGTTSKSYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIEELYTFLRQADARELGDLFHKLDDAKKNGGDVAAIQAEIDNYETHVVPII
ADIDAGFGNEEATYLLAKQMIEAGACCIQIENQVSDAKQCGHQDGKVTVPHEDFLAKINA
VRYAFLELGVDDGVIVARTDSLGAGLTQKIPVSTSEGDLAAQYNAFLKTTEVAGADDLSE
GDLVLKQGGKLVKPERLPNGLFRFKDNTGFDRVVLDCVTSLKHGADLLWIETEKPHVGQI
AEMVNAIREQVPNAKLVYNNSPSFNWTLNFRQQVFDAWTEEGKDVSGYDRAKLMSADYDD
SELAAEADEKIKSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGEEGMLAYVRG
VQRQEIRQGLACVKHQAMAGSDLGDTHKEYFSGEGALKASGEDNTMNQFDV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaatatcaacaagacattgataacttcgccaccttaaaggcagcacagaaagga
acgtgggaaggtataaacccagagttcgctgctcgcatgaaagttcaaaatcgtttcaaa
actggcttagacattgcccgttatactgcaggcatcatgcgtaaagacatggctgaatac
gacgcagattcgtctcagtacacacagtcactaggctgctggcatggctttgtaggccag
caaaaaatgctttcagttaaaaagcaccaaggtacaaccagcaaaagctacctttaccta
tctggttggatggtagcggcgcttcgctctgaatttggtccgctacctgaccaatcaatg
cacgaaaaaacgtcagtttctgcccttatcgaagagctttacaccttccttcgccaggca
gatgcccgtgaattaggcgaccttttccacaaactagacgacgcgaagaaaaacggcggc
gatgtagcggctatccaagctgaaatcgacaactacgaaactcacgtagtaccaattatt
gcggatatcgacgcaggttttggtaacgaagaagcaacttatctacttgcaaaacaaatg
attgaagcaggtgcatgctgtatccaaatcgaaaaccaagtgtcagatgcgaagcaatgt
ggtcaccaagacggtaaagtaaccgtgccacacgaagacttcctcgcaaaaatcaacgct
gtacgctatgcattccttgaactcggtgttgacgacggcgttattgttgcacgtactgac
tcactaggtgctggtctgactcaaaagatcccagtgtctacctctgaaggcgacctggct
gcacaatacaacgcattccttaaaaccacagaggttgctggcgcagacgacctatctgaa
ggcgacttagtattaaagcaaggtggcaagcttgttaagccagagcgtttgccaaacggt
ttgttccgctttaaagacaacacaggttttgaccgcgtagtacttgactgtgttacgtcg
ctcaagcacggtgctgacctactttggattgagactgaaaagcctcacgttggtcaaatt
gctgaaatggttaacgctattcgcgagcaagtaccaaacgctaagctggtatacaacaac
tctccatcgtttaactggacacttaacttccgtcagcaagtatttgatgcttggacagaa
gaaggtaaagatgtgtcgggttacgaccgtgcgaagcttatgtcagcagattacgatgat
agcgaacttgcagcagaagctgatgagaagattaagagcttccaagctgacgcagcacgt
gaagccggtatcttccaccaccttatcacgctacctacttaccacactgcagcactgtct
actgacaaccttgcgaaaggctacttcggtgaagaaggtatgcttgcttatgtacgcggt
gttcagcgtcaagaaattcgccaaggccttgcgtgtgttaaacaccaagcgatggcaggt
tctgacctaggtgatacgcacaaagagtacttctctggtgaaggtgcacttaaagcgtct
ggtgaagataacaccatgaatcagtttgacgtataa

DBGET integrated database retrieval system