KEGG   Alteromonas macleodii Deep ecotype: MADE_1013065Help
Entry
MADE_1013065      CDS       T00747                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MADE_1013065
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MADE_1013065
   00630 Glyoxylate and dicarboxylate metabolism
    MADE_1013065
Enzymes [BR:amc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MADE_1013065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3012036..3014231
Genome map
AA seq 731 aa AA seqDB search
MQGYITKGRLQVAEQLDNFINEQALPGTGVDQEAFWQGAEALFEKFIPQNRALLEKREQL
QRAIDDYHKAGNPVGGSEYTDFLKNIGYLVEQPANVTADTQNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISDEGGAEAGKSYNPVRGAKVVAKAKTYLDNMIPL
AKGSHADVTQYKIDTGKLAITLTDGDETTLANTEQWQGHQGDISAPSSLLFAHNGLHFEI
QIDPTHPIGESDPANVKDVLVEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGTLSI
EMTKGGKQLVRAMHDDRRYQPSKHAAKNQLKDGELVLSGRSLMFVRNVGHLMTNDAMLFD
GEEVPEGIMDGLITSLIAKHDLLGNSKFKNSREGSIYIVKPKMHGPEEVAFSNALFGAIE
PIIDVPTNTLKMGIMDEERRTSVNLQACIAEATSRVVFINTGFLDRTGDEIHTSMLAAPF
AEKAALKAMPWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMDAKIGHPKAGA
NTAWVPSPTAATLHALHYHDVNVFDVQKSLDASFDGLSDILTIPLLEDASTLTRESIKRE
IDNNVQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSVDQ
VKESLARMAVLVDEQNAGDPEYIPMTPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHAR
RREMKAKLAGN
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatatattacaaagggccgactacaggttgccgaacaactcgataactttatc
aacgaacaggcacttcctggcactggcgtcgaccaagaggctttttggcaaggcgctgaa
gctctcttcgaaaaattcatacctcaaaatcgcgcgctactagaaaagcgagagcaactt
cagcgcgctattgatgactaccacaaagctgggaacccggtaggtggtagcgaatacaca
gacttccttaaaaacattgggtatctcgttgagcagcctgcgaacgttaccgccgacaca
caaaacgtagatgcagaaattgctactatggcggggccgcagcttgtagtacctattaat
aatgctcgctatgcacttaacgcggtaaacgctcgctggggaagcctgtatgatgcattg
tacggcactgacgttataagcgatgaaggcggcgcagaagcagggaaaagttataaccct
gttcgtggcgctaaagtagtagcgaaagcgaaaacctacctagataacatgataccgcta
gcgaaaggcagccacgcagacgttacacagtataaaattgatacgggtaaactggctatc
acgcttaccgatggcgatgaaaccaccctagcgaatactgaacaatggcaaggacaccaa
ggcgatatcagtgccccatcaagcctgctttttgcgcacaatggcctgcactttgaaatt
caaattgaccctactcacccgattggcgagagtgatccagcgaacgtaaaagacgtgctg
gttgaagccgctctgactaccattatggactgcgaagattccgttgccgctgttgacgct
gaagacaaaaccttggtgtacagcaactggttaggtttgatgaaaggcacgctcagcatt
gaaatgacaaaaggcggtaagcaacttgttcgcgccatgcatgacgatagaaggtatcag
ccctctaaacacgctgcaaagaatcagttaaaagacggagaacttgttctttctggccga
agcctaatgttcgttcgaaacgtcggtcaccttatgaccaacgacgccatgctttttgac
ggtgaagaagtaccagaagggatcatggatggtttaatcacttcccttatcgcaaagcat
gaccttttaggtaatagtaaatttaaaaacagccgcgaaggcagtatttatattgttaaa
cctaaaatgcatgggcctgaagaagtggcgttctctaatgcgctatttggtgctatcgag
cctatcatcgacgttcccaccaacacccttaaaatgggtattatggatgaagaacgtcgt
acgagtgttaatctacaagcgtgtatcgctgaagcaacctcgcgggttgtgttcatcaac
acaggctttttggacagaacgggtgatgagatacatacctcaatgcttgccgcgccgttc
gcagaaaaagccgcccttaaagctatgccatggattaaagcttacgaaaccgcaaacgtt
gccgtaggtcttcgctgtggcctttctggtaaagcgcaaattggtaaaggcatgtggccg
atacctgatgaaatgcaaaatatgatggatgctaaaattggtcacccgaaggctggggca
aatacggcatgggtgccctctcctactgcagcgacactgcacgcgcttcattatcacgac
gtgaatgtgtttgacgttcaaaagtcgctagatgcgagttttgatgggttaagcgatata
ctcactattcctttgttagaagatgcctcaacgcttacacgtgaaagtataaagcgtgaa
atcgacaataacgttcagggcattttaggctacgttgtacgctgggttcaccaaggtgta
ggctgctctaaagttccagacatcaacaatgttggccttatggaagatcgcgcgacctta
cgtatttcatcgcagcatatcgcaaactggttagagcacggcattgtaagtgtagatcag
gtaaaagaatctttggcacgcatggcggtactggtagatgagcaaaacgcaggtgaccct
gaatatatccctatgacgcctgatttagatagctcaatcggcttcttagctgcaagcgac
ctcatcttcaaaggtaaagagcagcctagcggttacaccgaacctttgttgcacgcccgt
cgacgcgagatgaaggcgaagctggcaggtaattag

DBGET integrated database retrieval system