KEGG   Alteromonas macleodii Deep ecotype: MADE_1013065Help
Entry
MADE_1013065      CDS       T00747                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:amc01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:amc00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amc00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3012036..3014231
Genome map
AA seq 731 aa AA seqDB search
MQGYITKGRLQVAEQLDNFINEQALPGTGVDQEAFWQGAEALFEKFIPQNRALLEKREQL
QRAIDDYHKAGNPVGGSEYTDFLKNIGYLVEQPANVTADTQNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISDEGGAEAGKSYNPVRGAKVVAKAKTYLDNMIPL
AKGSHADVTQYKIDTGKLAITLTDGDETTLANTEQWQGHQGDISAPSSLLFAHNGLHFEI
QIDPTHPIGESDPANVKDVLVEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGTLSI
EMTKGGKQLVRAMHDDRRYQPSKHAAKNQLKDGELVLSGRSLMFVRNVGHLMTNDAMLFD
GEEVPEGIMDGLITSLIAKHDLLGNSKFKNSREGSIYIVKPKMHGPEEVAFSNALFGAIE
PIIDVPTNTLKMGIMDEERRTSVNLQACIAEATSRVVFINTGFLDRTGDEIHTSMLAAPF
AEKAALKAMPWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMDAKIGHPKAGA
NTAWVPSPTAATLHALHYHDVNVFDVQKSLDASFDGLSDILTIPLLEDASTLTRESIKRE
IDNNVQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSVDQ
VKESLARMAVLVDEQNAGDPEYIPMTPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHAR
RREMKAKLAGN
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatatattacaaagggccgactacaggttgccgaacaactcgataactttatc
aacgaacaggcacttcctggcactggcgtcgaccaagaggctttttggcaaggcgctgaa
gctctcttcgaaaaattcatacctcaaaatcgcgcgctactagaaaagcgagagcaactt
cagcgcgctattgatgactaccacaaagctgggaacccggtaggtggtagcgaatacaca
gacttccttaaaaacattgggtatctcgttgagcagcctgcgaacgttaccgccgacaca
caaaacgtagatgcagaaattgctactatggcggggccgcagcttgtagtacctattaat
aatgctcgctatgcacttaacgcggtaaacgctcgctggggaagcctgtatgatgcattg
tacggcactgacgttataagcgatgaaggcggcgcagaagcagggaaaagttataaccct
gttcgtggcgctaaagtagtagcgaaagcgaaaacctacctagataacatgataccgcta
gcgaaaggcagccacgcagacgttacacagtataaaattgatacgggtaaactggctatc
acgcttaccgatggcgatgaaaccaccctagcgaatactgaacaatggcaaggacaccaa
ggcgatatcagtgccccatcaagcctgctttttgcgcacaatggcctgcactttgaaatt
caaattgaccctactcacccgattggcgagagtgatccagcgaacgtaaaagacgtgctg
gttgaagccgctctgactaccattatggactgcgaagattccgttgccgctgttgacgct
gaagacaaaaccttggtgtacagcaactggttaggtttgatgaaaggcacgctcagcatt
gaaatgacaaaaggcggtaagcaacttgttcgcgccatgcatgacgatagaaggtatcag
ccctctaaacacgctgcaaagaatcagttaaaagacggagaacttgttctttctggccga
agcctaatgttcgttcgaaacgtcggtcaccttatgaccaacgacgccatgctttttgac
ggtgaagaagtaccagaagggatcatggatggtttaatcacttcccttatcgcaaagcat
gaccttttaggtaatagtaaatttaaaaacagccgcgaaggcagtatttatattgttaaa
cctaaaatgcatgggcctgaagaagtggcgttctctaatgcgctatttggtgctatcgag
cctatcatcgacgttcccaccaacacccttaaaatgggtattatggatgaagaacgtcgt
acgagtgttaatctacaagcgtgtatcgctgaagcaacctcgcgggttgtgttcatcaac
acaggctttttggacagaacgggtgatgagatacatacctcaatgcttgccgcgccgttc
gcagaaaaagccgcccttaaagctatgccatggattaaagcttacgaaaccgcaaacgtt
gccgtaggtcttcgctgtggcctttctggtaaagcgcaaattggtaaaggcatgtggccg
atacctgatgaaatgcaaaatatgatggatgctaaaattggtcacccgaaggctggggca
aatacggcatgggtgccctctcctactgcagcgacactgcacgcgcttcattatcacgac
gtgaatgtgtttgacgttcaaaagtcgctagatgcgagttttgatgggttaagcgatata
ctcactattcctttgttagaagatgcctcaacgcttacacgtgaaagtataaagcgtgaa
atcgacaataacgttcagggcattttaggctacgttgtacgctgggttcaccaaggtgta
ggctgctctaaagttccagacatcaacaatgttggccttatggaagatcgcgcgacctta
cgtatttcatcgcagcatatcgcaaactggttagagcacggcattgtaagtgtagatcag
gtaaaagaatctttggcacgcatggcggtactggtagatgagcaaaacgcaggtgaccct
gaatatatccctatgacgcctgatttagatagctcaatcggcttcttagctgcaagcgac
ctcatcttcaaaggtaaagagcagcctagcggttacaccgaacctttgttgcacgcccgt
cgacgcgagatgaaggcgaagctggcaggtaattag

DBGET integrated database retrieval system