KEGG   Alteromonas macleodii Deep ecotype: MADE_1013260Help
Entry
MADE_1013260      CDS       T00747                                 

Gene name
recR
Definition
recombinase RecR
Orthology
K06187  
recombination protein RecR
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MADE_1013260 (recR)
DNA repair and recombination proteins [BR:amc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MADE_1013260 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2818102..2818620)
Genome map
AA seq 172 aa AA seqDB search
MAFHLLERNRTGAIDLSNVLHNAMEHIHHCKRCRTFTEDELCEICRHPEREASGLLCIVE
SPQDVLAIEQTLSYKGQYFVLMGHLSPIDGVGPEEIGLTELEGRLSAGGINEVILATNPT
VEGEATAHYIAQLCASHNVDASRIAHGVPVGGELEYIDGNTLTHAFSGRRKL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccaccttttggaacgaaaccgtacaggtgctatcgacctcagtaacgttttg
cacaatgccatggagcacatacatcactgtaagcgctgtagaacgtttaccgaagatgag
ctttgcgaaatatgccgtcacccagagagagaggctagtggcttattgtgtatcgtggaa
agccctcaagatgtgttagctatcgagcaaacgttgagctacaaaggccagtatttcgtg
ctgatggggcatctatcgcctatcgatggcgtggggcctgaagaaataggattaactgaa
cttgaagggcgccttagcgcgggtggcattaacgaggtcattcttgctacaaacccaacg
gttgagggagaagccacggcgcattatattgcccagttgtgcgccagtcacaacgtggat
gcctctcgtatagcccacggtgtgcctgttgggggggagttagagtatatcgatggcaac
acccttactcatgcattttcaggccgtcgcaaattataa

DBGET integrated database retrieval system