KEGG   Alteromonas macleodii Deep ecotype: MADE_1013625Help
Entry
MADE_1013625      CDS       T00747                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MADE_1013625
Enzymes [BR:amc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MADE_1013625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2562923..2565118)
Genome map
AA seq 731 aa AA seqDB search
MNNNQHSVSSFFDNLFGIEAIDKFVAKEFGFIEQLSQEDAFIWAGILVYLSYMQRNGHSC
IYLKDVAGTTLFEDAVALENNASAPSAKSSASEQNMALTQVMEPKVQQNKGEKAPKTGFE
VPELTPLLKIVKSALGNEQLAKLFVYDNGRLYSRRYYEFEQEVARSVVERAVLHPLHDDV
ADNVKALWPAIFPTTTTDQQDWQQIAVAKSLMQRFCVINGGPGTGKTYTVLRLLLALQAC
DEELKIVLAAPTGKAQQRMTESIMNSVEGLRGKVSDTALDSVPTEAVTLHRLLGLREHGV
ATKYNQHNKLSADVLIVDEASMVDLALMTRIVRALPDHARLYFIGDADQLPAVELGNVLE
QLVSDETALDFSHENPLAGGENSSNERTLGGVPSSMRQHIATLCPHLPLLPVNEQAKSYV
ATLQAPQRFKGQVARVATAIQRGDANGALAAIAQKNSGSKQGDNASQPKSADEKSINTNS
RSRLQPGVHLWPESQLGGRELQQLAKESFLPLFEAQSAEEALNRLNYVRWLTPIRKGAMG
VEGLNNLVFDAIKHKIRRREGHFYQGQPIMIVKNHHPQRLSNGEVGVIWPDSTGKLYAWF
YQDTYVEGQQAGKSLNDSSNNSSAQNLGQQKQALRSISLSRVPQFETVYAMTIHKSQGSE
FNHVVLILPKPESEKAANLFHRGLVYTGLTRAKDGCLIISDSNTFSGMVATVDKRYSGLS
SAISRCAEKVL
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaatcaacattcagtgtcgtcgtttttcgataacttatttggcattgaagcc
atcgacaaattcgtggcaaaagaatttggctttatagagcaactgtctcaagaggacgcg
tttatatgggcgggaatattggtatacctgtcgtatatgcagcgaaatggacatagctgt
atctatttgaaagacgtggcgggaaccacgctttttgaagacgcggttgccttagaaaat
aatgcgtcagcgccttcagcaaaaagcagtgccagtgagcaaaatatggctctcactcaa
gtcatggagcctaaggtacagcaaaataaaggggaaaaagcgcctaaaacaggctttgag
gtaccagagttaacgcctttgcttaaaatagtgaaaagcgcccttggcaacgagcaatta
gccaagcttttcgtatacgacaatggcagactttatagccgccggtactatgaatttgaa
caagaagtggcgagaagcgtagtagaacgcgcagtacttcaccctttacatgatgacgta
gccgacaacgtaaaagccttgtggcctgctatatttcctaccaccactacagatcaacaa
gactggcagcaaatagcggtagccaaaagtttaatgcagcgattttgcgtaataaacggc
gggccgggtacaggtaaaacctacaccgtgctgcgtttattacttgcgctacaggcctgc
gatgaagagctaaaaattgtactggcagcccctacgggcaaagcgcagcagcgtatgact
gagtctatcatgaatagcgtagaagggcttcgcggtaaggtaagcgataccgcgcttgat
agtgtgcctacagaggccgttaccctgcataggttgttaggactcagagaacatggcgtt
gcgacaaagtacaatcaacacaacaaactatctgccgacgtacttattgttgatgaagcc
agtatggttgatttagccctaatgacgcgcatagttcgggcgttacctgaccacgcgcgg
ttatatttcattggtgatgctgatcagcttccagcggttgagctaggcaatgtgcttgaa
cagttagttagcgatgaaactgcgctggatttttctcacgaaaacccattagccggcggt
gaaaacagtagtaatgagcgtacacttggcggtgtaccttcttcaatgcgacagcatatt
gccacgctttgcccgcatttgcctctgttacctgtaaatgaacaggcaaaaagctacgta
gcaacgttgcaagcgccgcaacgctttaaagggcaggtggctcgggtggcaacggcaatt
cagcgcggcgatgcgaacggtgcgcttgctgctattgcacaaaagaatagtggcagtaag
caaggcgataatgcttcacagccgaaaagcgctgatgaaaaaagcatcaatactaatagc
cgctcacgtttacagcctggtgttcacttatggccagaaagtcaacttggtggtcgtgag
ctacagcagctagcgaaagagagcttcttacccctatttgaagcccaaagtgcagaggag
gcgctcaaccgccttaattacgttaggtggttaacccctatacgtaaaggcgccatgggg
gtggaaggtttgaataacttggtgttcgatgccattaagcacaagatcaggcgacgtgag
ggacacttctatcaaggtcagcctattatgattgtaaaaaatcatcatccacagcgtttg
tccaacggcgaggtaggtgtaatttggccggatagcacgggcaaattgtatgcgtggttc
taccaggatacgtatgtcgaaggacaacaagcaggcaagagcttgaacgatagctcaaat
aacagtagcgcgcaaaatctagggcaacagaagcaagcgctacgcagcatatcgctatca
agagtaccgcagtttgaaaccgtgtatgccatgactattcacaagtctcagggctctgag
tttaatcacgttgtgcttattttgcccaaacccgaaagcgaaaaagccgctaacctgttt
caccgggggttagtctatacagggttaacgcgggcaaaagacgggtgcttaattatttcc
gatagcaatacattcagcggcatggtggcaacggttgataaacgctattcaggcttatct
agcgcaataagccgatgcgctgaaaaagtactctga

DBGET integrated database retrieval system