KEGG   Alteromonas mediterranea DE: MADE_1014975Help
Entry
MADE_1014975      CDS       T00747                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00010  Glycolysis / Gluconeogenesis
amc00020  Citrate cycle (TCA cycle)
amc00620  Pyruvate metabolism
amc01100  Metabolic pathways
amc01110  Biosynthesis of secondary metabolites
amc01120  Microbial metabolism in diverse environments
amc01130  Biosynthesis of antibiotics
amc01200  Carbon metabolism
Module
amc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MADE_1014975
   00020 Citrate cycle (TCA cycle)
    MADE_1014975
   00620 Pyruvate metabolism
    MADE_1014975
Enzymes [BR:amc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MADE_1014975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Peptidase_M23 DUF4813
Motif
Other DBs
NCBI-ProteinID: AEA99129
UniProt: F2GCY2
Position
complement(3323901..3325940)
Genome map
AA seq 679 aa AA seqDB search
MSDIQKIIVPDVGGDEVEVIELCVAVGDNIEADEGVVTVESDKASMDIPAPFEGEIVSLS
VSVGDKIKEGDVIGEMKAAGGDSSDESTAEESSSDNASQEEAPKQDEAPKEESKSEAAPA
ASGGSEVIEVAVPDIGSDDEVDVIDVLVSAGDTIEKEDGLITLETDKATMDVPSTHAGTV
KEVFISTGDKVKEGTVVIKLEIAGSSSSSSESASSDASSEASAPAAQESEKQESAPAASA
SSETIEVAVPDIGEDGEVDVIDVLVSVGDTVEKEDGLITLETDKATMDVPSTHAGTIKEV
FIKTGDKVKQGTLVVKLENSGGSSEQAPSAPKAEKPAEAPKQEAPKQASQQEASQGRSPV
PPAPEAKNTGKAHASPSVRRIAREFGVDLTQVSGSGPKNRILKEDVQAYVKAELAKPRTA
AASGSAPVGDNVLQIVPVKPVDHSKFGEIEEQKLSRIQKISGPFLHRNWATIPHVTQFDE
ADITDVEDFRKEQNAYHAKIKSGLKITPLVFVMKAVAKALEKYEVFNSSLSDDGESLIIK
KFINIGIAVETPGGLVVPVIRDVNKKGIEELSRELIETSKKAREGKLKAADMQGGTFTIS
SLGGIGGTAFTPIVNAPEVAILGVSKSEMKPKWNGKEFEPRLMVPLSLSYDHRVIDGAVG
ARFSTEVAANLTDLRRIIL
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcaaaagattatcgtacccgacgtaggcggtgacgaagttgaagttatc
gagctatgtgttgccgtaggcgacaacatcgaagccgatgaaggcgttgttactgttgaa
agtgacaaggcgtcaatggacatcccagcaccgtttgaaggtgaaattgtaagtctgtct
gtatcagtaggcgataaaatcaaagaaggcgatgtgattggtgaaatgaaggctgcaggt
ggcgacagttctgatgagagcaccgctgaagaatcatcttcagacaacgcttcacaagaa
gaagcgcctaagcaagatgaagcaccgaaagaagaaagcaagtcagaggcagcaccagct
gcgtctggcggcagtgaagtgattgaagtcgcagtaccggatattggctctgacgacgaa
gttgacgttatcgatgtattggtttcagcgggcgacaccatcgaaaaagaagatggtctt
attaccctggaaaccgataaagcaacgatggacgttccttcaacacatgcaggtacagtg
aaagaagtattcatcagtactggcgataaagtgaaagaaggcacagttgttattaagctt
gaaatagcgggttcaagctcgtcttcaagtgaatcggcttctagcgatgcttcttctgaa
gcatctgcaccggctgcgcaggaaagcgaaaagcaagagtcagctcctgcggcgtctgca
agtagcgaaactatcgaagttgctgtaccagacattggtgaagacggtgaagttgacgtt
atcgacgtgcttgtatcggtaggcgataccgttgaaaaagaagacggcctgattacgcta
gaaactgataaagccaccatggatgtaccttcaacgcacgcaggtaccattaaagaagtc
tttatcaaaacaggcgataaagttaagcaaggcacattagttgttaagctagaaaatagc
ggtggctcatctgaacaggcaccatcagcacctaaagcagaaaagcctgctgaagcgcct
aagcaagaagcacctaaacaagcgtcacagcaagaagcctctcaaggccgttctcctgtg
ccgccagcgccagaagctaagaatacaggtaaagcacatgcttcaccttcggttcgccgt
attgctcgcgagtttggtgtagacctgactcaagttagcggctctggccctaaaaaccgt
atcttgaaagaagacgttcaagcttacgtgaaagctgagctggcgaaacctcgcacagca
gccgcttctggcagcgcaccagtaggcgacaacgtacttcaaattgtgccagttaaacct
gttgatcacagcaagtttggtgaaattgaagagcaaaagctttcgcgcattcagaagatt
tctggcccgttcttacaccgtaactgggcgacgattccgcacgttacgcagtttgatgaa
gccgatatcacagacgtagaagatttccgtaaagagcaaaacgcttaccacgcgaagatt
aagtctggtcttaagattacgccgctagtattcgtaatgaaagcggtagcgaaagccctt
gagaaatacgaagtatttaactcatcactgtctgacgacggcgaaagcttaattatcaag
aagttcattaacattggtattgcggtggaaacaccgggcggccttgtagttcctgttatt
cgcgacgtgaataagaaaggcattgaagaactttctcgcgagcttatcgaaacatcgaag
aaagcccgtgaaggtaagcttaaagcggctgacatgcagggtggtacgtttactatctct
agcctaggtggtattggcggtacggcgtttacgcctattgtaaatgcaccagaagtcgcc
atattaggtgtgtctaagtctgagatgaagcctaagtggaatggtaaagagttcgagccg
cgcttaatggtgccgctaagcttgtcttacgaccaccgagtaatcgatggtgcggtaggt
gcaagattctctactgaggttgctgcaaacctaactgacttacgcagaatcatactttaa

DBGET integrated database retrieval system