KEGG   Alteromonas macleodii Deep ecotype: MADE_1015090Help
Entry
MADE_1015090      CDS       T00747                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:amc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MADE_1015090
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MADE_1015090
Enzymes [BR:amc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MADE_1015090
Two-component system [BR:amc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MADE_1015090
Bacterial motility proteins [BR:amc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MADE_1015090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3346699..3347736)
Genome map
AA seq 345 aa AA seqDB search
MSVKVLIVDDSALMRKLFTELFEKEGFIVRVARNGEEALTKAVEFEPDCITLDINMPVMD
GMTCLAMLKKLYTCPIIMVSSLTQKGATITLEALALGASDFVLKTGGTVSRDISDLEIPL
INKIHALTKTGKPQRPTTKTPPVVKQKVVRSNKNVPFEVVLVGVSTGGPKKLEHLVANLS
SSFPAPVVISQHMPASFTNALAKRLDGLSPLSVVEVDSKMPMKPGTVYLAKGDADLAFSK
VGKDVFARPVPSSPSFLWHPSIDRMVDSALTCYKPLSMLCVQLTGMGCDGVAAMSKAFKE
GATTIAESEATSVVFGMPKELIEAGCASFVLDSPKVASKLNALCR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaagtgcttattgttgatgattcagcgttaatgcgaaagttatttacggag
ctcttcgagaaagagggctttatcgttcgggtagcgcgcaatggtgaagaagccttaacc
aaagccgtagagttcgaaccagactgcataacattagatattaacatgccggtaatggac
ggtatgacatgcttagctatgctgaaaaagctttatacctgccccatcattatggtgtct
tcattaacacaaaaaggcgcgactattacgttagaggcactggcgctcggtgctagtgac
tttgttctaaaaactggcggcactgtttcaagggacatttcagatttagaaatcccactt
atcaacaaaattcacgcactcacgaaaacaggtaagccccaacgtcccaccaccaaaaca
ccgcctgtcgttaaacaaaaagtggttcggagtaacaaaaatgtaccctttgaagtggtg
ttagtcggggtttcaaccggtgggcctaagaagctagagcatctggtggcaaacctaagc
tcttcttttcctgctcccgttgttatttctcagcatatgccggcatctttcactaatgca
ttggcaaagcggttggatggattaagcccactgagtgtcgttgaagtcgacagcaagatg
ccaatgaaaccaggcacggtttatttagcgaaaggtgatgcggaccttgctttttcgaaa
gtaggaaaggacgtttttgcacggcccgtgccgtcgagcccaagttttttatggcacccc
agcatagatcgtatggttgatagtgcgctcacctgttacaagccgctgtccatgttatgc
gttcagctgacgggaatgggatgcgacggtgttgccgccatgagtaaagcttttaaagag
ggagcaacaactatcgcagagagcgaagccacctcggtggtgtttggtatgcctaaagag
cttattgaagctggttgtgccagtttcgtcctagacagtcccaaggtagcatcgaaactg
aatgcgctttgccgttaa

DBGET integrated database retrieval system