KEGG   Alteromonas macleodii Deep ecotype: MADE_1015175Help
Entry
MADE_1015175      CDS       T00747                                 

Definition
UDP-N-acetylmuramyl peptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:amc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:amc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3369272..3370822)
Genome map
AA seq 516 aa AA seqDB search
MVVSAFIQSTKALLAKFGVDAPDIRIEGLTLDSREVNTRLAFLAIKGHERDGRDFIPQAI
SLGARVILAQTDDSEAHGQMEMRDHSVIISLYELPQMLSALAAAFYDYPAQKMTTVAVTG
TNGKTSTVQLLTQLKDALGTRSASIGTLGSSVFEGDATQWSNTPAANTTPDAIRMQYLLA
DFVQSEVRHAAFEASSHALVQGRLGTVKTDIAVFTNLTRDHLDYHGTMEEYGKAKRLLLC
QPGLKAVVLNANDDESNKWDNVADNAITRIWTGIDESADGALFRAHNNPQSRHCFATNAS
YHSGGCSFELVSSWGSAAISLPLFGKFNISNVLSAIGTLLAEGERFDAVVKAVNAITPVP
GRMEVFPVPGAANLVVDYAHTPDALEKVLLSAKFHTAGKVWCVFGCGGDRDTGKRPLMGQ
AAEAGADAIVITTDNSRSEDPESIAQDIITGLKDSSLAVSIPDREQAIRHCLAHADKSDI
IIVAGKGHEDYQIIGDKKTNYNERAVVARLQQEYSK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtggtagttagtgcctttattcaaagtaccaaagcattgctggcgaagtttggtgtagac
gcaccggatatacgtattgaaggccttactttagatagccgcgaagtgaacacgcggtta
gcttttttagccattaaagggcatgagcgcgacggccgtgattttatccctcaggcaata
agtttaggggcccgtgtaattctggcgcaaactgacgacagtgaagctcatggccaaatg
gaaatgcgcgaccacagcgttatcatttctctttatgagctaccccaaatgctctctgca
ttagctgcagccttttatgactatcccgcacaaaagatgacaacggtagcggttactgga
actaacggaaaaacctctacagttcaattgcttacgcaacttaaagacgcgttaggtacg
cgtagtgcaagcataggtaccctaggtagcagtgtgtttgaaggcgatgcgacgcaatgg
tcgaacacgcctgcggccaataccacgccagatgccatacgtatgcagtacttgttggca
gactttgtgcaaagcgaagtgcgccatgccgcctttgaggccagttctcacgcgttggtt
caggggcgacttggtacggttaaaaccgatatagctgttttcaccaaccttacacgggat
catctcgattatcacggcacgatggaggaatacggtaaggctaagcgcttactgctttgt
cagcctgggttaaaagcggtggtgttaaacgctaacgatgatgaaagtaataaatgggac
aatgttgctgacaatgctattacccgcatttggacgggtattgatgaaagtgctgatggt
gcgttatttcgcgcccacaacaatcctcaaagtcgccattgtttcgccacaaatgcttct
tatcattccggtggatgtagctttgaactggtgagctcgtggggaagtgccgccatttcc
ctaccgcttttcggtaaattcaatattagtaatgtgctaagcgcaataggaacacttctg
gcagaaggtgagcgttttgacgcggtggtaaaagcggttaatgcgatcacccctgtgcca
gggcgaatggaagtgtttccagtacccggtgctgccaatttggtggtggactacgcccac
acccctgacgcactggaaaaggtgctgctaagcgccaagtttcataccgctggaaaagtg
tggtgtgtatttggttgtggcggtgatagagacacaggaaagcgcccattaatggggcag
gctgctgaagctggcgctgatgccattgttatcaccactgataacagccgtagcgaagac
cctgaatctatcgcgcaggacattattaccggtttaaaagacagtagccttgcggtgtca
attcctgacagagagcaagctattcgtcattgcctagcgcatgctgataaaagcgacatc
atcattgtggccggaaaaggccatgaagattaccaaattatcggtgacaaaaagactaac
tataacgaacgtgcggttgtggcgcggctgcaacaggagtacagcaaatga

DBGET integrated database retrieval system