KEGG   Alteromonas macleodii Deep ecotype: MADE_1016700Help
Entry
MADE_1016700      CDS       T00747                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:amc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:amc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3700927..3702054
Genome map
AA seq 375 aa AA seqDB search
MKKPPLILTNALVFIISGAIAFIGVPLWVAYQGIDWAEIGTAIFLFYFTGMSITAGYHRL
WSHKTYDANIVVRVILAIGGAMALQNSILHWSSDHRVHHRHVDDNDKDPYSAKKGLWFAH
IGWMLREYQAKRYDDYSNCKDLQKDSVVMWQHKYYLPIVLAANFGITGLLGYLNGDVMGM
ILVAGVLRLVLVHHVTFFINSLAHFWGSQPYTDKNTARDNGVLAFFTFGEGYHNYHHIFE
YDYRNGIRWYQFDPTKWLIKGLSYVGLTSNLRKVPEERIEKALAAMQLQRASEKVSVLPN
AEEMMHTIQEEYDLLMQRMSEYYATKKRVMRVKQRTLKRSIEGLELAYKYKELKHAFAVQ
KEKWTHLQSLSLQMA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctcctcttatcctaactaatgcgctggtatttataatatctggcgcaata
gcatttattggtgtgccgctatgggtggcgtatcaaggcattgattgggcagaaattggt
actgctatatttctgttctactttaccggcatgtcgattactgctggttatcaccgtctg
tggtctcacaagacctacgatgcaaacattgttgtgcgtgtcattcttgctatcggcggc
gctatggccttgcagaatagtattttgcattggtcttctgatcaccgtgtgcatcaccgc
catgtagacgacaacgacaaagatccttactctgcaaagaaagggctttggttcgcgcac
atcggctggatgttacgcgagtatcaagctaagcgttacgatgactacagcaactgtaaa
gacctgcaaaaagatagcgtggtgatgtggcagcacaaatactacttacctatcgtactc
gctgctaactttggcattactggtctattaggctatttgaacggcgacgtaatgggcatg
attttagtagcgggcgttcttcggttggtgctagttcatcatgttacgttttttattaat
tctctggcccatttttggggtagtcagccttataccgataaaaatacggcgcgagataat
ggcgttttagctttcttcacgtttggcgagggttatcacaactaccaccatatctttgaa
tacgattaccgcaacggcattcgttggtatcagtttgatcctactaaatggctaatcaaa
gggctgtcttatgtaggtttaacgtcgaaccttcgcaaagtacctgaagagcgcatcgaa
aaggcactggcggccatgcagcttcaaagggctagtgagaaagtatcggtactgcccaac
gctgaagaaatgatgcacactattcaagaagagtacgacctgcttatgcagcgaatgagt
gaatactacgcgacgaaaaagcgcgtgatgcgtgttaagcaacgcaccttaaaacgcagt
attgaagggttagaacttgcatataagtacaaagaactgaagcacgcgtttgctgtgcag
aaagaaaaatggacacatttgcaaagcttatcgttacaaatggcctag

DBGET integrated database retrieval system