KEGG   Alteromonas macleodii Deep ecotype: MADE_1016700Help
Entry
MADE_1016700      CDS       T00747                                 

Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MADE_1016700
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MADE_1016700
Enzymes [BR:amc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MADE_1016700
Lipid biosynthesis proteins [BR:amc01004]
 Desaturase
  First
   MADE_1016700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3700927..3702054
Genome map
AA seq 375 aa AA seqDB search
MKKPPLILTNALVFIISGAIAFIGVPLWVAYQGIDWAEIGTAIFLFYFTGMSITAGYHRL
WSHKTYDANIVVRVILAIGGAMALQNSILHWSSDHRVHHRHVDDNDKDPYSAKKGLWFAH
IGWMLREYQAKRYDDYSNCKDLQKDSVVMWQHKYYLPIVLAANFGITGLLGYLNGDVMGM
ILVAGVLRLVLVHHVTFFINSLAHFWGSQPYTDKNTARDNGVLAFFTFGEGYHNYHHIFE
YDYRNGIRWYQFDPTKWLIKGLSYVGLTSNLRKVPEERIEKALAAMQLQRASEKVSVLPN
AEEMMHTIQEEYDLLMQRMSEYYATKKRVMRVKQRTLKRSIEGLELAYKYKELKHAFAVQ
KEKWTHLQSLSLQMA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctcctcttatcctaactaatgcgctggtatttataatatctggcgcaata
gcatttattggtgtgccgctatgggtggcgtatcaaggcattgattgggcagaaattggt
actgctatatttctgttctactttaccggcatgtcgattactgctggttatcaccgtctg
tggtctcacaagacctacgatgcaaacattgttgtgcgtgtcattcttgctatcggcggc
gctatggccttgcagaatagtattttgcattggtcttctgatcaccgtgtgcatcaccgc
catgtagacgacaacgacaaagatccttactctgcaaagaaagggctttggttcgcgcac
atcggctggatgttacgcgagtatcaagctaagcgttacgatgactacagcaactgtaaa
gacctgcaaaaagatagcgtggtgatgtggcagcacaaatactacttacctatcgtactc
gctgctaactttggcattactggtctattaggctatttgaacggcgacgtaatgggcatg
attttagtagcgggcgttcttcggttggtgctagttcatcatgttacgttttttattaat
tctctggcccatttttggggtagtcagccttataccgataaaaatacggcgcgagataat
ggcgttttagctttcttcacgtttggcgagggttatcacaactaccaccatatctttgaa
tacgattaccgcaacggcattcgttggtatcagtttgatcctactaaatggctaatcaaa
gggctgtcttatgtaggtttaacgtcgaaccttcgcaaagtacctgaagagcgcatcgaa
aaggcactggcggccatgcagcttcaaagggctagtgagaaagtatcggtactgcccaac
gctgaagaaatgatgcacactattcaagaagagtacgacctgcttatgcagcgaatgagt
gaatactacgcgacgaaaaagcgcgtgatgcgtgttaagcaacgcaccttaaaacgcagt
attgaagggttagaacttgcatataagtacaaagaactgaagcacgcgtttgctgtgcag
aaagaaaaatggacacatttgcaaagcttatcgttacaaatggcctag

DBGET integrated database retrieval system