KEGG   Alteromonas macleodii Deep ecotype: MADE_1018035Help
Entry
MADE_1018035      CDS       T00747                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amc00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:amc00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:amc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3941248..3942942
Genome map
AA seq 564 aa AA seqDB search
MDRRTFIRLSSFAGASVAVSTGLAGCTVSTSANSQPQTKSEFTHGVASGDPLKDAVIIWT
RAVPTSSSALVKADILWEMASDAAFTDVVSSGVVEAKATHDFTVKVDVSGLQPASKYFYR
FRSANNVSPVGETRTLPEADVSKVTFGIFSCSNYPAGFFTPYMEAAKDDNMDYVLHLGDY
IYEYDGKGYATEHAKEIGRTYAPDNDTELYTLTDYRNRYALYRTDEGLLALHQNKPFIVV
WDDHEITNDTYKDGAENHQADEGDFYERRAAAVQAYYEWLPIRPPFGTERLEIYRQFTFG
NLLDLYMLDTRVLARDKQLEYANYRDAETKAFDQAGFMKDISDPSRGLLGETQRNWLHSS
MQQSQAKWQVLGQQLLIGRMLFPVSIFNGVERKEIPAHVHRLANIKRKQKQGAALSEQEL
ALINTVMPYNLDAWDGYPVEREQVLMQLKSIGKPVIALAGDTHNAWHNKLTLKDGTEVGV
ELATSGVTSPGMEHYLSMDDEMAETLADDLPLLIDDLQYCNLHQRGFMTLTVSEDEAKAT
WHYVDAILTKAGKVVNTHSFEIKA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagaacgtttattaggctgtcgtcattcgcgggtgcgagcgtggcagtatct
actgggctagcggggtgtacagttagcacgtcagcaaacagtcagcctcaaactaaatcg
gaatttacccatggcgtggccagtggcgacccgttaaaagatgcagtgatcatttggact
cgcgcggttcctacatcaagctcggctttagttaaagccgatattttgtgggaaatggca
agcgatgcagcatttaccgacgtggtaagtagcggagtcgttgaggctaaagcgacacat
gactttaccgtaaaagtagatgtgtcaggtcttcagcctgcaagcaaatacttttatcgc
ttcagaagtgcgaataatgtgagccctgttggcgaaactcgcacattgccggaagcagac
gtttctaaggtcacattcggcatattttcttgctcgaactaccctgccggctttttcacg
ccttatatggaagccgccaaagatgacaacatggattatgtactgcatttgggcgactac
atatatgagtacgatggaaagggttacgccaccgaacatgccaaagagattggccgaacc
tatgcgccagataacgataccgagctatatacgctaaccgactaccgaaaccgctacgcg
ttgtatcgcaccgacgaagggttgcttgcgctgcatcaaaacaagccttttattgtggtt
tgggatgatcacgaaattactaacgacacttacaaagacggtgcggaaaatcaccaagca
gacgaaggtgatttttatgaacgtcgcgctgcggcagtgcaagcctattatgagtggctg
cctattcgcccaccatttggcactgaacgtttagaaatctaccgtcagtttacctttggc
aacctgcttgatttatacatgcttgatacccgcgttttagcccgggataagcagcttgaa
tacgccaactatcgcgacgctgaaactaaagcttttgaccaagcaggctttatgaaagat
atcagtgatcctagtcgtgggcttttaggtgaaacccagcgcaactggctgcattcatct
atgcagcaaagtcaggcaaaatggcaggtgttaggccaacagctattaataggccgcatg
cttttccctgtatcgatatttaacggcgttgagcgtaaagaaatacctgctcatgtacat
aggcttgcgaatatcaaacgcaaacaaaagcaaggtgcagcactcagtgagcaagagctt
gcacttatcaatacggtaatgccctacaatttagacgcatgggacggctaccccgttgaa
cgggaacaggttctcatgcagctaaaatccatcggcaaacccgttatagctctagcaggc
gatactcataatgcatggcacaataagttaaccctcaaagacggaacggaagtgggtgtt
gaacttgccacctctggggtgacgtcacccggcatggaacattatttaagtatggatgat
gaaatggcagaaacacttgctgatgaccttccccttcttattgatgatttacagtattgt
aatcttcaccagcgcggctttatgacattgaccgttagcgaggatgaagctaaagcgacc
tggcactatgtggatgcgattttgaccaaggctggaaaggtggttaacacgcatagcttt
gagattaaggcatag

DBGET integrated database retrieval system