KEGG   Alteromonas macleodii Deep ecotype: MADE_1018435Help
Entry
MADE_1018435      CDS       T00747                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MADE_1018435
Enzymes [BR:amc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MADE_1018435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4028539..4029036
Genome map
AA seq 165 aa AA seqDB search
MHKEHVYIGVGSNLGDSEGKAQKAFDAMGKLEDTRVLKTSSLYSSKPMGPQDQPDYINAV
CLIETALKPHGLLKQLQRIELEEGRERKGERWGPRTLDLDILLYGSENIDTADLIIPHYG
MAEREFVMVPLFEIAPNMVMHDGKPISAWVANCSLDGLRRLRSSN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagaacacgtatatattggtgtaggcagtaaccttggcgatagtgaaggtaaa
gcccaaaaagcattcgacgcaatgggcaagttagaagatacccgtgttttaaagacctcg
tcactgtactctagtaaaccaatgggcccacaggatcagccagactacatcaatgcagta
tgcttgatagaaactgcgttgaagcctcatgggctgctaaagcagcttcagcgcatagag
cttgaagagggccgtgagcgcaaaggcgaacgctggggccctcggaccctcgatttggat
attttgctatacggcagtgaaaatattgatactgccgacctaatcattccgcactatgga
atggctgagcgagaattcgtcatggtgccgctgtttgaaattgcgcccaatatggtgatg
cacgacggcaagccgatttctgcttgggtagcaaactgctccctagatggacttcgacgc
ctacgctcttccaattag

DBGET integrated database retrieval system