KEGG   Alteromonas mediterranea DE: MADE_1020200Help
Entry
MADE_1020200      CDS       T00747                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00330  Arginine and proline metabolism
amc00332  Carbapenem biosynthesis
amc01100  Metabolic pathways
amc01130  Biosynthesis of antibiotics
amc01230  Biosynthesis of amino acids
Module
amc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MADE_1020200
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MADE_1020200
Enzymes [BR:amc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MADE_1020200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEB00163
UniProt: F2GCH6
Position
complement(4411548..4412645)
Genome map
AA seq 365 aa AA seqDB search
MNRFTWQRAVIKVGSALIAPEGNECSGRYLLSLARFITASREAGKEVILVSSGSVAAGRS
KVKVRHNASIAEKQAMAAIGQNLMMANWQRFFDFPCAQVLLTADDLRDRTRYVNIKNTLR
EILKHNALPIVNENDTVAANELKVGDNDNLGAYTALVAQADTLIICSDIDGLFTADPRKD
NTATLIPHVGKIDSTIYGLAGGAGTAVGTGGMRTKIEAADKCTSSGIQTLIVNGRKGETF
DALLEGEVPGTLFEASSTPANARRLWLTHTLKTAGRIEVDSGAKEALMQKGASLLPSGII
DVVGQFEQGDAVEVICQGAVVAKGLCLYNAKDLGLIKGKKSKDIASVLGYETTDVAVHRD
DMVLY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttttacttggcaacgtgccgttattaaagttggcagtgccctcattgcgcca
gagggaaatgaatgcagtggtcgctacttactttctttagcgcgttttattaccgcaagc
cgagaggcgggcaaagaagttattctggtctcttctggtagtgtggccgctgggcgcagc
aaagtgaaggtaaggcacaatgcttctattgccgagaagcaagcgatggcagcaatcggt
caaaaccttatgatggctaactggcagcgctttttcgactttccttgtgcgcaagtgtta
cttacagcggatgacttgcgggatagaacccgttacgtcaacatcaaaaacaccttgcga
gaaattttaaagcataacgccctgcctatcgtgaatgaaaacgatacggtggccgctaac
gagctaaaggttggagataacgacaatttaggcgcctacaccgcattggtagcccaagcc
gacaccttaattatttgctctgatattgatggtttgtttaccgctgaccctcgaaaagac
aacaccgcaacgcttattcctcatgttgggaaaattgatagcaccatttatggactggct
ggtggtgctggtactgcggtcggcacgggtggtatgcgcacgaaaatagaagccgcagac
aaatgtaccagtagcggtattcaaacgcttatcgttaacggtagaaaaggcgaaaccttt
gatgcactgcttgaaggcgaagtgccgggtacgctgtttgaagcaagcagcacaccggcc
aatgcacgcaggctgtggcttactcacacccttaaaaccgctggcagaatagaagtagat
agcggcgctaaagaagcattgatgcaaaaaggtgcatctttgttaccttcaggaataatc
gatgtcgtcggacaatttgagcaaggtgatgcggttgaagtcatctgccaaggtgccgtt
gtcgctaagggactttgtttgtataacgcaaaagacttgggcctcataaaagggaaaaag
tcgaaagacattgccagtgtgttaggttatgagacaaccgatgtcgctgttcatcgcgac
gacatggtgctgtattaa

DBGET integrated database retrieval system