KEGG   Alteromonas macleodii Deep ecotype: MADE_1020200Help
Entry
MADE_1020200      CDS       T00747                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4411548..4412645)
Genome map
AA seq 365 aa AA seqDB search
MNRFTWQRAVIKVGSALIAPEGNECSGRYLLSLARFITASREAGKEVILVSSGSVAAGRS
KVKVRHNASIAEKQAMAAIGQNLMMANWQRFFDFPCAQVLLTADDLRDRTRYVNIKNTLR
EILKHNALPIVNENDTVAANELKVGDNDNLGAYTALVAQADTLIICSDIDGLFTADPRKD
NTATLIPHVGKIDSTIYGLAGGAGTAVGTGGMRTKIEAADKCTSSGIQTLIVNGRKGETF
DALLEGEVPGTLFEASSTPANARRLWLTHTLKTAGRIEVDSGAKEALMQKGASLLPSGII
DVVGQFEQGDAVEVICQGAVVAKGLCLYNAKDLGLIKGKKSKDIASVLGYETTDVAVHRD
DMVLY
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttttacttggcaacgtgccgttattaaagttggcagtgccctcattgcgcca
gagggaaatgaatgcagtggtcgctacttactttctttagcgcgttttattaccgcaagc
cgagaggcgggcaaagaagttattctggtctcttctggtagtgtggccgctgggcgcagc
aaagtgaaggtaaggcacaatgcttctattgccgagaagcaagcgatggcagcaatcggt
caaaaccttatgatggctaactggcagcgctttttcgactttccttgtgcgcaagtgtta
cttacagcggatgacttgcgggatagaacccgttacgtcaacatcaaaaacaccttgcga
gaaattttaaagcataacgccctgcctatcgtgaatgaaaacgatacggtggccgctaac
gagctaaaggttggagataacgacaatttaggcgcctacaccgcattggtagcccaagcc
gacaccttaattatttgctctgatattgatggtttgtttaccgctgaccctcgaaaagac
aacaccgcaacgcttattcctcatgttgggaaaattgatagcaccatttatggactggct
ggtggtgctggtactgcggtcggcacgggtggtatgcgcacgaaaatagaagccgcagac
aaatgtaccagtagcggtattcaaacgcttatcgttaacggtagaaaaggcgaaaccttt
gatgcactgcttgaaggcgaagtgccgggtacgctgtttgaagcaagcagcacaccggcc
aatgcacgcaggctgtggcttactcacacccttaaaaccgctggcagaatagaagtagat
agcggcgctaaagaagcattgatgcaaaaaggtgcatctttgttaccttcaggaataatc
gatgtcgtcggacaatttgagcaaggtgatgcggttgaagtcatctgccaaggtgccgtt
gtcgctaagggactttgtttgtataacgcaaaagacttgggcctcataaaagggaaaaag
tcgaaagacattgccagtgtgttaggttatgagacaaccgatgtcgctgttcatcgcgac
gacatggtgctgtattaa

DBGET integrated database retrieval system