KEGG   Amycolatopsis mediterranei U32: AMED_0456Help
Entry
AMED_0456         CDS       T01269                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMED_0456 (gpm)
   01230 Biosynthesis of amino acids
    AMED_0456 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_0456 (gpm)
  Energy metabolism
   00680 Methane metabolism
    AMED_0456 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMED_0456 (gpm)
Enzymes [BR:amd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AMED_0456 (gpm)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AMED_0456 (gpm)
  Exosomal proteins of melanoma cells
   AMED_0456 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
459790..460539
Genome map
AA seq 249 aa AA seqDB search
MGEIGTLVLLRHGQSTWNAENLFTGWVDVPLSEQGEGEARQGGRLLADAGLLPDVVHTSL
LRRAISTANIALDAADRHWIPVKRDWRLNERHYGALQGKDKKQTLAEFGEEQFMLWRRSY
DTPPPPIDPQDEWSQVGDPRYAGLGDQAPLTECLKDVVERLLPYWESEIVPDLRAGKTVL
VAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLRYDLTEDLQPVKPGGEYLDPDAAKEA
AAAVANQGR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatcgggacgttggtgctgctgcggcacgggcagagcacgtggaacgcggaa
aacctgttcaccggctgggtggacgtaccgctttcggagcagggcgagggcgaagcccgc
cagggcggccggctgctggccgacgccgggctgctcccggacgtggtgcacacctcgctg
ctgcgccgcgcgatctccaccgcgaacatcgcgctggacgccgccgaccggcattggatc
ccggtgaagcgcgactggcgcctcaacgagcgccactacggcgcgctgcagggcaaggac
aagaagcagaccctcgccgagttcggcgaggagcagttcatgctctggcgccgctcgtac
gacaccccgccgccgccgatcgacccgcaggacgagtggagccaggttggcgacccccgc
tacgccggcctcggcgaccaggcgccgctgaccgagtgcctgaaggacgtcgtcgagcgg
ctgctgccgtactgggagtccgaaatcgtgccggacctccgcgcgggcaagaccgtgctg
gtcgccgcgcacggcaactcgctgcgcgcgctggtcaagcacctcgacggcatctccgac
gccgacatcgcgggcctgaacatcccgaccggcatcccgctgcgctacgacctcaccgag
gacctgcagccggtgaagccgggtggcgagtacctcgaccccgacgccgccaaggaagcc
gccgccgcggtggcgaaccagggccgctga

DBGET integrated database retrieval system