KEGG   Amycolatopsis mediterranei U32: AMED_0456Help
Entry
AMED_0456         CDS       T01269                                 

Gene name
gpm
Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00010  Glycolysis / Gluconeogenesis
amd00260  Glycine, serine and threonine metabolism
amd00680  Methane metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
amd01230  Biosynthesis of amino acids
Module
amd_M00002  Glycolysis, core module involving three-carbon compounds
amd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_0456 (gpm)
  Energy metabolism
   00680 Methane metabolism
    AMED_0456 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMED_0456 (gpm)
Enzymes [BR:amd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AMED_0456 (gpm)
Membrane trafficking [BR:amd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AMED_0456 (gpm)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AMED_0456 (gpm)
  Exosomal proteins of melanoma cells
   AMED_0456 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 9434672
NCBI-ProteinID: YP_003762680
UniProt: A0A0H3CVH8
Position
459790..460539
Genome map
AA seq 249 aa AA seqDB search
MGEIGTLVLLRHGQSTWNAENLFTGWVDVPLSEQGEGEARQGGRLLADAGLLPDVVHTSL
LRRAISTANIALDAADRHWIPVKRDWRLNERHYGALQGKDKKQTLAEFGEEQFMLWRRSY
DTPPPPIDPQDEWSQVGDPRYAGLGDQAPLTECLKDVVERLLPYWESEIVPDLRAGKTVL
VAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLRYDLTEDLQPVKPGGEYLDPDAAKEA
AAAVANQGR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatcgggacgttggtgctgctgcggcacgggcagagcacgtggaacgcggaa
aacctgttcaccggctgggtggacgtaccgctttcggagcagggcgagggcgaagcccgc
cagggcggccggctgctggccgacgccgggctgctcccggacgtggtgcacacctcgctg
ctgcgccgcgcgatctccaccgcgaacatcgcgctggacgccgccgaccggcattggatc
ccggtgaagcgcgactggcgcctcaacgagcgccactacggcgcgctgcagggcaaggac
aagaagcagaccctcgccgagttcggcgaggagcagttcatgctctggcgccgctcgtac
gacaccccgccgccgccgatcgacccgcaggacgagtggagccaggttggcgacccccgc
tacgccggcctcggcgaccaggcgccgctgaccgagtgcctgaaggacgtcgtcgagcgg
ctgctgccgtactgggagtccgaaatcgtgccggacctccgcgcgggcaagaccgtgctg
gtcgccgcgcacggcaactcgctgcgcgcgctggtcaagcacctcgacggcatctccgac
gccgacatcgcgggcctgaacatcccgaccggcatcccgctgcgctacgacctcaccgag
gacctgcagccggtgaagccgggtggcgagtacctcgaccccgacgccgccaaggaagcc
gccgccgcggtggcgaaccagggccgctga

DBGET integrated database retrieval system