KEGG   Amycolatopsis mediterranei U32: AMED_0851Help
Entry
AMED_0851         CDS       T01269                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMED_0851 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMED_0851 (sdhD)
   00650 Butanoate metabolism
    AMED_0851 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AMED_0851 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(908606..909019)
Genome map
AA seq 137 aa AA seqDB search
MADLALANPRAPKRPAARRSNFELYSWLFMRISGLVLVILVLGHLLIMNILDGGVHRINW
GFVAGRWASPFWQFWDLLMLWLAEIHGGNGLRTIIDDYARKDSTRFWLKILLYVSMVLIL
AVGTMVIFTFDPNMPAN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggccgacctcgccctcgcgaacccgcgcgcgccgaagcgcccggccgcgcgccggagc
aacttcgagctctacagctggctgttcatgcggatctccgggctggtcctggtcatcctg
gtgctcggccacctgctgatcatgaacatcctcgacggcggcgtgcaccggatcaactgg
ggcttcgtcgccggccgctgggcctcgccgttctggcagttctgggacctgctgatgctg
tggctcgccgagatccacggcggcaacgggctgcgcacgatcatcgacgactacgcccgc
aaggacagcacgcggttctggctgaagatcctgctgtacgtctcgatggtgctgatcctg
gccgtcggcacgatggtgatcttcacgttcgacccgaacatgcccgcgaactaa

DBGET integrated database retrieval system