KEGG   Amycolatopsis mediterranei U32: AMED_1126Help
Entry
AMED_1126         CDS       T01269                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMED_1126 (hemD)
Enzymes [BR:amd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AMED_1126 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1184198..1185301
Genome map
AA seq 367 aa AA seqDB search
MSDVLPLAGFVIGITAARRADELGALLVRKGASVRYGPAIRIVPLTDDTELHAATSRLLE
APVDAVVATTGIGFRGWLEAAEGWGLGDSLLERLSSASLLARGPKVTGALRAAGLSESYS
PASESNAELLQHLLSSGVDGLRIAVQLHGEPLPYFVDTLRASGAEVIEIPVYRWVGPVDP
GPVDRLLDGVLDGSIHALPFTSAPAAASLIALARRTGRLPGLVSALSGPVVAACVGPITA
GPLAALGVPTVQPHRARIGALARTVAETLVARSPRLRAGGHSIELRGQAAIVDGEWREVA
PAPMALLRALAASPGRVVSRRELISALPGGGEEHAVETAIGRLRTALGGGKVVQTVVKRG
YRLAVDA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatgtgctcccactggccggtttcgtgatcggcatcaccgcggcgcgccgggct
gacgagctcggcgcgctgctggtgcgcaagggggcgagcgtccgctacggcccggcgatc
cggatcgtgccgctgacggacgacaccgagctgcacgcggcgacgtcgaggctgctggaa
gcgccggtggacgcggtggtggcgacgacgggcatcggtttccgtggctggctcgaagcg
gccgaggggtgggggctgggggattccctgctcgagcggctgtcttcggcgtcgctgctg
gcccgcgggccgaaggtgaccggtgcgttgcgggcggccgggctttcggagtcgtattcg
cccgcctcggaaagcaacgccgagctgctgcagcacctgctctcgtcgggcgtcgacggg
ctgcggatcgcggtccagctgcacggcgagccgttgccgtacttcgtggacacgctgcgg
gcgtccggggcggaggtcatcgagatcccggtgtaccgctgggtcggcccggtcgacccg
ggcccggtggaccggctcctggacggcgtcctggacggctcgatccacgcgctgccgttc
acgagcgccccggcggcggcgtcgctcatcgccctggcccggcgcacgggccggctgccg
gggctcgtttcggcgctgtccggcccggtggtggcggcgtgcgtcggcccgatcacggct
ggaccgttggccgctttgggggtgccgacggtccagccgcaccgcgcccgcatcggcgcg
ctggcccggacggtggcggagaccctggtggcccgttccccgcggttgcgggcgggaggt
cactcgatcgagctgcgcggccaggcggccatcgtggacggcgagtggcgcgaagtggcc
ccggcaccgatggcgctgttgcgggcgctggcggcgtcgccggggcgggtggtgtcccgg
cgtgagctgatctcggcgctgccgggaggcggcgaggagcacgcggtcgagacggcgatc
gggcggctgcggacggcgctggggggcgggaaggtcgtccagacggtggtgaagcgcgga
tatcggctggcggtcgacgcctga

DBGET integrated database retrieval system