KEGG   Amycolatopsis mediterranei U32: AMED_1391Help
Entry
AMED_1391         CDS       T01269                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amd  Amycolatopsis mediterranei U32
Brite
Enzymes [BR:amd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AMED_1391 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1483569..1484234
Genome map
AA seq 221 aa AA seqDB search
MLTKKRGRSRMFAGGAVLALIAAFLPGTAWADTVITTNQTGNNNGYYYSFWSAGGGSVSM
TLGSGGNYRTNWSNVNNFVAGKGWSNGSRRNVNYSGSFNPSGNSYLSLYGWTSNPLVEYY
IVDNWGSWRPTGTYKGTVTSDGGTYDIYQTTRYNAPSVEGNKTFNQYWSVRQQRRTGGTI
TTGNHFDAWGRAGMHLGSFNYYMILATEGYQSSGNSNLTVG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaagaaacgcggccgcagcaggatgttcgccggcggcgccgtccttgcgctg
atcgccgcattcctgcccggaaccgcctgggccgacaccgtcatcacgaccaaccagacc
ggcaacaacaacgggtactactactcgttctggtccgccggtggcggctcggtctccatg
acgctcgggtccggcgggaactaccggacgaactggagcaacgtcaacaacttcgtcgcc
ggcaagggctggagcaacggcagccggcggaacgtgaactactccggcagcttcaacccc
tccggcaacagctacctgtcgctctacggctggacgtccaacccgctcgtcgagtactac
atcgtcgacaactggggcagctggcggccgaccgggacgtacaagggcaccgtgaccagc
gacggcggcacgtacgacatctaccagacgacccgctacaacgcgccgtccgtcgagggc
aacaagacgttcaaccagtactggagcgtgcgccagcagcggcggaccggcggcaccatc
accaccggcaaccacttcgacgcgtggggccgggccggcatgcacctcggcagcttcaac
tactacatgatcctcgcgaccgaggggtaccagagcagcggcaactccaacctgacggtg
ggctga

DBGET integrated database retrieval system