KEGG   Amycolatopsis mediterranei U32: AMED_1638Help
Entry
AMED_1638         CDS       T01269                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:amd01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amd00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1750214..1751494
Genome map
AA seq 426 aa AA seqDB search
MTEQAKQAAAELAAQWANDPRWAGVQRSYSAEDVIKLRGSVVEEHTLARRGAEKLWDLLH
TEDYIHALGALTGNQAVQQVRAGLQAIYLSGWQVAADANLSGQTYPDQSLYPANSVPAVV
RRINNALGRADQINWAEGNTDIDWYAPIVADAEAGFGGPLNAFELMKGMIAAGAAGVHWE
DQLASEKKCGHLGGKVLIPTKQHERTLNAARLASDVLNVPTLVVARTDAQAATLLTSDVD
ERDRQFLTGGRTAEGFYEVTNGIEPCIERGLAYAQYADLLWMETSEPDLEVARKYAEAIK
AKFPDQMLAYNCSPSFNWKKHLDDATIAKFQRELGHMGYKFQFITLAGFHALNYSMFDLA
HGYAREGMTAYVDLQEREFASESRGYTATKHQREVGTGYFDNVATALNPESSTTALKGST
EEAQFH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaggccaagcaggcggccgcggagctggcggcgcagtgggcgaacgacccc
cgctgggcgggcgtgcagcgctcctactcggccgaagacgtgatcaagctgcgcggcagc
gtcgtcgaggagcacaccctggcccgccgcggggcggagaagctgtgggacctgctgcac
accgaggactacatccacgcgctcggggcgctcaccggcaaccaggccgtccagcaggtc
cgcgccggcctgcaggcgatctacctgtccggctggcaggtcgcggccgacgccaacctg
tccggccagacctaccccgaccagagcctctacccggccaactcggtgccggccgtggtc
cgccgcatcaacaacgcgctgggccgcgccgaccagatcaactgggccgaaggcaacacc
gacatcgactggtacgccccgatcgtcgccgacgccgaggccggcttcggtggcccgctc
aacgcgttcgagctgatgaagggcatgatcgccgccggcgccgcgggtgtgcactgggag
gaccagctcgcgtccgagaagaagtgtggtcacctcggcggcaaggtcctcatcccgacc
aagcagcacgagcgcacgctgaacgccgcccgcctcgcgtccgacgtgctgaacgtgccg
accttggtcgtcgcccgcaccgacgcgcaggccgcgacgctgctgaccagcgacgtcgac
gagcgcgaccggcagttcctcaccggcggccgcaccgccgagggcttctacgaggtcacc
aacggcatcgagccctgcatcgagcgcggcctggcctacgcccagtacgccgacctgctc
tggatggagacctccgagccggacctcgaggtggcgcgcaagtatgccgaggccatcaag
gcgaagttcccggaccagatgctggcctacaactgctcgccgtcgttcaactggaagaag
cacctggacgacgcgacgatcgcgaagttccagcgcgagctcggccacatgggctacaag
ttccagttcatcacgctggccggcttccacgcgctgaactactcgatgttcgacctggcg
cacggctacgcccgcgagggcatgaccgcctacgtcgacctgcaggagcgcgagttcgcg
tcggagagccgcggctacaccgcgaccaagcaccagcgcgaggtcggcaccggctacttc
gacaacgtcgcgacggcgctgaacccggagagctcgaccaccgcgctcaagggctccacc
gaagaagcccagttccactga

DBGET integrated database retrieval system