KEGG   Amycolatopsis mediterranei U32: AMED_1646Help
Entry
AMED_1646         CDS       T01269                                 

Definition
glycosyl transferase family protein
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMED_1646
Enzymes [BR:amd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AMED_1646
Glycosyltransferases [BR:amd01003]
 Polysaccharide
  Storage polysaccharide
   AMED_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1757638..1758915)
Genome map
AA seq 425 aa AA seqDB search
MRVLMLSWEYPPVAIGGLARHVHALATHLTRQGHEVVVLCRHAAGTDAGTHPRTDRVVEG
VRVIRVAEDPMHVTFERDLVAWTLAMGHAMIRAAQDLLRTWQPDVVHAHDWLVAHPAIAI
AEAARVPLVGTIHATEAGRHSGWLSHPLNQQVHSVEWWLANRADALITCSQAMRREVAYL
FEVEAADVTVIHNGIEERGWQVPADEIARAREVYSPAGAPLLLYFGRLEWEKGVQDLLAA
LPRIRRRHPGTRVVVAGKGRHFDELVEQSRKLRVRRAVDFVGHLSDRDLRAALAAADAVV
LPSRYEPFGIVALEAAAAKAPLVASTAGGLGEVVVHGETGLAFSPGDVAALASAVTTVLS
DAEAAAERARAAQSRLAADFDWGRIAEATAEVYRRAKPGEPVELPRPKIATGNAFEPVPA
EIPEV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgctgatgctgtcctgggagtacccgcccgtggccatcgggggcctggcccgg
cacgtccacgcgctcgctacccacctcacccgccagggccacgaggtcgtcgtgctctgc
cggcacgccgcgggcaccgacgccgggacgcacccgcgcaccgaccgcgtcgtcgagggc
gtgcgggtcatccgggtcgccgaagacccgatgcacgtgacgttcgaacgggacctcgtc
gcctggacgctggccatggggcacgccatgatccgcgccgcgcaggacctgctgcgcacc
tggcagcccgacgtcgtccacgcgcacgactggctggtcgcccacccggccatcgcgatc
gccgaggcggcgcgggtgccgctggtcggcacgatccacgcaaccgaggcggggcggcac
tccggttggctgtcgcacccgctgaaccagcaggtccactcggtcgaatggtggctcgcg
aaccgcgccgacgcgctgatcacctgctcgcaggcgatgcgccgcgaggtcgcgtacctc
ttcgaggtcgaggcggccgacgtcacggtgatccacaacggcatcgaggaacgcggctgg
caggtgcccgcggacgagatcgcccgcgcccgcgaggtctacagcccggccggcgcgccg
ctgttgctctatttcggacgactcgagtgggagaagggcgtgcaggacctgctggccgcg
ctcccccgcatccggcgccgccacccgggcacccgcgtggtcgttgccggaaaaggacga
cacttcgacgagctggtcgagcagtcgcgcaagctgcgggtgcggcgcgcggtcgacttc
gtcgggcacctctccgaccgcgacctccgcgcggcgctggccgcggccgacgccgtcgtg
ctgccgagccggtacgagccgttcggcatcgtcgcactggaggccgcggccgcgaaggca
ccgctggtggcgtcgacggccggcgggctcggcgaggtcgtcgtccacggtgagaccggg
ctggcgttcagtcccggggatgtcgccgcactggcctccgcggtgacaacggtgctctcc
gacgccgaggccgcggccgagcgggcccgggccgcgcagtcccggctggccgcggacttc
gactggggccgcatcgccgaagcgaccgccgaggtctaccggcgggcgaagccgggcgaa
ccggtcgagctgccccggcccaagatcgccaccggcaacgctttcgaaccggtgccggcc
gagatcccggaagtctag

DBGET integrated database retrieval system