KEGG   Amycolatopsis mediterranei U32: AMED_1649Help
Entry
AMED_1649         CDS       T01269                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1761322..1762827)
Genome map
AA seq 501 aa AA seqDB search
MSEGTFCLVVHSHLPWLPHHGSWPVGEEWLYQAWAHSYLPMVELLERFADEGRRDVLTLG
VTPVLAAQLDDPYSIRAFHDWLGHWQLRAQHAATLWRGDPLLRELAAAEHRTAVRAAEEL
GTRWRHGFSPVLRSLVDNSTIELLGGPLAHPFQPLLDPRVREFALNAGLADTALRVGTRP
EGIWAPECGYAPGMENDYAAAGVRRFLVDGPSLRGETWAARPVGGTDVLAFGRDLEVTYR
VWSPKAGYPGHSAYRDFHTWQHEVGLKAARVTGKTVEPQDKAPYDPALAADVLATHVKDF
VETVVTRLRSLKRQHGREALVVAAYDTELFGHWWHEGPAWLEGVLRALPEAGVRVTTLEG
AMEAGHVGEPIDLPSSSWGSGKDWRVWDGEQVKDVVAANAALQDRLLDLVAGLDRTARDT
VADQAVAEAMLALESDWAFMVTKDSAADYARRRAAVHTERFDALAGLLRRGDRARAVELA
AAYRADDGPFGHLDARALKHD
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggggaccttctgcctcgtcgtgcacagccacctgccgtggctaccgcaccac
gggagctggccggtcggcgaggaatggctctaccaggcgtgggcgcactcctacctgccg
atggtcgagctcttggagcgcttcgccgacgaaggccgccgcgacgtgctgacgctgggc
gtgacgccggtgctggccgcacagctcgacgacccgtacagcatccgcgcgttccacgac
tggctcggccactggcagctgcgcgcccagcacgcggcgacgctgtggcgcggcgacccg
ctgctgcgcgagctcgccgcggccgagcaccggaccgccgtccgcgcggccgaagagctc
ggaacgcggtggcggcacgggttctccccggtcctgcggtccctggtcgacaattcgacc
atcgagctgctcggcggcccgctcgcccacccgttccagccgctgctggacccgcgggtg
cgcgagtttgcgctgaacgccggtctcgccgacacggccctgcgggtcgggacgcgaccg
gaggggatctgggcccccgagtgcggctacgcgcctggtatggaaaacgactacgcggcg
gcgggcgtgcgacggttcctggtcgacggcccctcgctgcgcggcgagacctgggccgcc
cggccggtcggcggcaccgacgtcctcgcgttcggccgggacctcgaggtcacctaccgc
gtctggtcgccgaaggccggctaccccgggcactccgcctaccgcgacttccacacctgg
cagcacgaggtcggcctcaaggcggcgcgggtcaccggcaagaccgtcgagccgcaggac
aaggcgccctacgacccggcgctcgccgcggatgtgctggcgacgcacgtgaaggacttc
gtcgagaccgtcgtgacgcgcctgcggtcgctgaagcggcaacacgggcgtgaggcgctc
gtggtcgccgcgtacgacacggagctgttcgggcactggtggcacgaaggaccggcgtgg
ctggaaggcgtcctgcgcgcgctccccgaggccggcgtgcgggtgacgaccctggagggc
gcgatggaagccggccacgtcggcgagccgatcgacctgccttcgtcgtcgtggggctcg
ggcaaggactggcgcgtctgggacggcgagcaggtcaaggacgtggtcgccgccaacgcg
gcgctgcaggaccggctgctggacctggtcgccgggctggaccggacggcccgggacact
gtcgccgaccaggccgtcgccgaggcgatgctggcgctggaaagcgactgggcgttcatg
gtcaccaaggactcggccgcggactacgcgcgccgtcgtgcggcggtccacaccgagcgc
ttcgacgcgctggccgggctgctgcgccgcggcgatcgcgcgcgcgccgtcgagctcgcc
gccgcctaccgcgccgacgacggaccgttcgggcacctcgacgcccgggcactgaagcac
gactga

DBGET integrated database retrieval system