KEGG   Amycolatopsis mediterranei U32: AMED_1762Help
Entry
AMED_1762         CDS       T01269                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1893854..1894636
Genome map
AA seq 260 aa AA seqDB search
MLINAVPQRQGAVGPRAAELPDGCVALSELAGHVLGRPVHHVRQTRSVSEVDRGIAARAV
LTGANRAAQLAALEAPGGPVLTIGGDCGVELVPIGVARFRHGPGLGVAWFDAHPDLNTAD
SSPSGAFHGMVLRSLFGEGDPEFAADPALTPGNVFLAGTRAFDPEERAAVARGLVVTSVE
ALTAVEKLYVHVDLDVLDPGEFAGLNYPEPDGWTIARLVSELDALARFEVVGAGITECVG
TPREVEVLEPVLAAIGRLLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcaacgcggtaccgcaacggcaaggcgcggtgggaccgcgcgcggcggagctg
ccggacggctgcgtggcgctctcggagctggccgggcacgtgctcggccggccggtgcac
cacgtccggcagacgcgttcggtgtccgaagtggaccgtgggatcgcggcccgtgccgtg
ctgaccggcgcgaaccgcgcggcccagctggcggccctggaggcgccgggcggcccggtg
ctgacgatcggcggtgactgcggcgtcgagctggtgccgatcggcgtggcccgcttccgc
cacgggcccgggctgggcgtcgcgtggttcgacgcccacccggacctgaacacggcggac
tcgtcgccctcgggggcgttccacggcatggtgctgcggtcgctgttcggcgagggcgac
ccggagttcgccgcggacccggccctgactccggggaacgtcttcctcgccgggacacgg
gcgttcgacccggaggaacgggcggcggtggcccgcgggctggtggtgacgtcggtcgag
gcgctgacggccgtcgaaaagctgtacgtgcacgtggatctggacgtgctggacccgggc
gagttcgcgggcttgaactacccggagccggacggctggacgatcgcgcggctggtgtcg
gaactggacgcgctggcccggttcgaggtggtcggcgcggggatcaccgagtgcgtgggg
acgccgcgtgaagtcgaggtcctggagccggtgctggcggcgatcggccgcctgctcggc
tga

DBGET integrated database retrieval system