KEGG   Amycolatopsis mediterranei U32: AMED_1762Help
Entry
AMED_1762         CDS       T01269                                 

Gene name
rocF
Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00220  Arginine biosynthesis
amd00330  Arginine and proline metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01130  Biosynthesis of antibiotics
amd01230  Biosynthesis of amino acids
Module
amd_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    AMED_1762 (rocF)
   00330 Arginine and proline metabolism
    AMED_1762 (rocF)
Enzymes [BR:amd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AMED_1762 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 9435979
NCBI-ProteinID: YP_003763975
UniProt: A0A0H3CYY7
Position
1893854..1894636
Genome map
AA seq 260 aa AA seqDB search
MLINAVPQRQGAVGPRAAELPDGCVALSELAGHVLGRPVHHVRQTRSVSEVDRGIAARAV
LTGANRAAQLAALEAPGGPVLTIGGDCGVELVPIGVARFRHGPGLGVAWFDAHPDLNTAD
SSPSGAFHGMVLRSLFGEGDPEFAADPALTPGNVFLAGTRAFDPEERAAVARGLVVTSVE
ALTAVEKLYVHVDLDVLDPGEFAGLNYPEPDGWTIARLVSELDALARFEVVGAGITECVG
TPREVEVLEPVLAAIGRLLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcaacgcggtaccgcaacggcaaggcgcggtgggaccgcgcgcggcggagctg
ccggacggctgcgtggcgctctcggagctggccgggcacgtgctcggccggccggtgcac
cacgtccggcagacgcgttcggtgtccgaagtggaccgtgggatcgcggcccgtgccgtg
ctgaccggcgcgaaccgcgcggcccagctggcggccctggaggcgccgggcggcccggtg
ctgacgatcggcggtgactgcggcgtcgagctggtgccgatcggcgtggcccgcttccgc
cacgggcccgggctgggcgtcgcgtggttcgacgcccacccggacctgaacacggcggac
tcgtcgccctcgggggcgttccacggcatggtgctgcggtcgctgttcggcgagggcgac
ccggagttcgccgcggacccggccctgactccggggaacgtcttcctcgccgggacacgg
gcgttcgacccggaggaacgggcggcggtggcccgcgggctggtggtgacgtcggtcgag
gcgctgacggccgtcgaaaagctgtacgtgcacgtggatctggacgtgctggacccgggc
gagttcgcgggcttgaactacccggagccggacggctggacgatcgcgcggctggtgtcg
gaactggacgcgctggcccggttcgaggtggtcggcgcggggatcaccgagtgcgtgggg
acgccgcgtgaagtcgaggtcctggagccggtgctggcggcgatcggccgcctgctcggc
tga

DBGET integrated database retrieval system