KEGG   Amycolatopsis mediterranei U32: AMED_1926Help
Entry
AMED_1926         CDS       T01269                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:amd00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2068107..2068988)
Genome map
AA seq 293 aa AA seqDB search
MAITLGPNQYGKAEVRLVTVRRDGPVHHLKDLTVSTSLRGELAATHLTGDNAGVLATDTQ
KNTVYAFAKEAPVGEIEDFGLRLARHFVGTQENITGARIKIDEHGWDRIAVGAEPHDHAF
SRSGDERRTTAVTVQDGRAWIVSGIDGLTLLKSTGSEFHGFPRDEYTTLAETGDRILATA
VTAKWRYQGEDIDWASSHREIRRVMLETFATKHSLSLQQTLYAMGSAVLEARPEVAEVRL
SLPNKHHFLVDLSPFGLKNDNEVFYAADRPYGLIEGTILRDDAEDAGPAWDLH
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtggccatcaccctgggccccaaccagtacggcaaggcggaggtccgcctggtgacggtg
cgccgcgacgggccggtgcaccacctgaaggacctgacggtgtcgacgtcgctgcgcggc
gagctggccgcgacgcacctgaccggcgacaacgccggggtgctggcgaccgacacgcag
aagaacacggtgtacgccttcgcgaaggaggcgccggtcggtgagatcgaggacttcggc
ctgcgcctggcccggcacttcgtcggcacgcaggagaacatcacgggcgcgcgcatcaag
atcgacgagcacggctgggaccggatcgccgtcggcgccgagccgcacgaccacgcgttc
agccgatccggcgacgagcgccgcacgacggcggtgacggtgcaggacggccgcgcgtgg
atcgtgtccggcatcgacggcctgacgctgctgaagtccacgggttcggagttccacggc
ttcccccgcgacgagtacacgaccctggcggagacgggcgaccggatcctggcgacggcc
gtcacggcgaagtggcgttatcagggcgaggacatcgactgggcttcgagtcaccgcgag
atccggcgggtgatgctcgagacgttcgcgacgaagcacagcctttcgctgcagcagacg
ctgtacgcgatgggttcggcggtgctggaggcgcggccggaggtggccgaggtgcggttg
tcgctgccgaacaagcaccacttcctggtggacttgagcccgttcgggctgaagaacgac
aacgaggtgttctatgcggcggaccggccgtacgggctgatcgagggcaccatcctgcgc
gacgacgccgaggacgcggggccggcctgggacctccactga

DBGET integrated database retrieval system