KEGG   Amycolatopsis mediterranei U32: AMED_2168Help
Entry
AMED_2168         CDS       T01269                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMED_2168 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMED_2168 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    AMED_2168 (sucB)
Enzymes [BR:amd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AMED_2168 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2322514..2324307)
Genome map
AA seq 597 aa AA seqDB search
MAYSVTLPELGESVTEGTVTRWLKQEGDTVEVDEPLLEISTDKVDTEVPSPVAGTVVKIS
AQEDETVEVGGELAVIDDGTGGVPESSSSSAAPAQEEQQESEPEPEQSSEPEPQAEDSAP
SKPDTAPAAGGEGTEVKLPELGESVTEGTVTRWLKAVGDSVEVDEPLLEISTDKVDTEVP
SPVAGTVLEIRAGEDETVEVGGVLAVIGDAGAAPKAESKPEPKPEPKPEPQPEPKPEPVQ
EAKPEPKPEPKPEPQAAPAAKAAEAAPAAAAKDGSADGPYVTPLVRKLASEHGIDLASLT
GSGVGGRIRKQDVLAAAEEKQKAAAAPAPAAAAPAAAAAPAAPAARPAAAVSPELAALRG
TVQKASRIRQITATKTRESLQIAAQLTQVQEVDVTKIAKLRQRAKAGFKEREGVNLTFLP
FFAKATVEALKQHPNVNASYNEDTKEITYHGAVHLGIAVDTERGLLSVVIHDAGELSLAG
LAHRIADLAGRARAGQIKPDELSGGTFSITNIGSVGALFDTPIIVQPQSGILGTGAVVKR
PVVIADADGNDTIAVRSMAYLPLTYDHRLVDGADAGRFLTTIKQRLEEGNFESELGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcctactccgtcacattgccggagctcggggagagcgtcaccgaaggcaccgtcacc
cggtggcttaagcaggagggcgacaccgtcgaggtcgacgagccgttgctcgagatctcg
accgacaaggtcgacaccgaggtgccctccccggtggcgggcacggtcgtgaagatcagc
gcccaggaggacgagaccgtcgaggtcggcggcgagctcgccgtcatcgacgacggcacc
ggcggcgtgccggagtcctcttcttcttccgccgccccggcccaggaagagcagcaggag
tccgagccggagccggagcagtcgtccgagcccgagccgcaggccgaggacagcgcgccg
agcaagccggacaccgcgccggccgccggtggcgaaggcaccgaggtgaaactgcccgag
ctgggcgagagcgtcaccgagggcaccgtcacgcgctggctgaaggcggtcggcgactcg
gtcgaggtcgacgagccgctgctcgagatctccaccgacaaggtcgacaccgaggtgccg
tcgccggtcgccggcacggtgctggagatccgcgcgggcgaggacgagaccgtcgaggtc
ggcggcgtcctggccgtgatcggcgacgccggtgcggcgccgaaggcggagtcgaagccg
gagcccaagcccgagccgaagccggaaccccagccggagccgaagcccgagccggttcag
gaggccaagcccgagcccaagccggaaccgaagcccgagccgcaggccgcccccgcggcc
aaggcggccgaagcggccccggccgccgcggcgaaggacggttcggcggacggcccgtac
gtcacgccgctggtccgcaagctcgcgtcggagcacggcatcgacctcgcgtcgctgacc
ggcagcggcgtcggcggccggatccgcaagcaggacgtcctggccgcggccgaggagaag
cagaaggccgccgccgctccggcgccggccgcggccgctccggctgccgccgctgccccg
gcggcgcccgccgcgcgtccggcggccgcggtgtcgccggaactggccgcgctgcgcggc
accgtgcagaaggccagccggatccgccagatcacggccaccaagacccgcgagtcgctg
cagatcgccgcgcagctcacgcaggtccaggaggtcgacgtcacgaagatcgccaagctg
cggcagcgggcgaaggcgggcttcaaggagcgcgagggcgtcaacctgacgttcctgccg
ttcttcgcgaaggccacggtcgaggcgctcaagcagcacccgaacgtcaacgcgtcctac
aacgaggacacgaaggagatcacctaccacggcgccgtgcacctgggcatcgcggtggac
accgagcgcgggctgctctcggtcgtgatccacgacgcgggcgagctgagcctggccggt
ctcgcgcaccggatcgccgacctggcgggccgcgcgcgggcgggccagatcaagccggac
gagctgtcgggcggcaccttctcgatcacgaacatcggcagcgtcggcgcgttgttcgac
acgccgatcatcgtgcagccgcagtcgggcattctcggcaccggcgcggtcgtcaagcgc
ccggtggtgatcgcggacgccgacggcaacgacacgatcgccgtccggtcgatggcgtac
ctcccgctgacctacgaccaccgcctggtggacggggccgacgcgggccgcttcctgacg
acgatcaagcagcgcctggaagagggcaacttcgagagcgaactcggcctctga

DBGET integrated database retrieval system