KEGG   Amycolatopsis mediterranei U32: AMED_2168Help
Entry
AMED_2168         CDS       T01269                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00020  Citrate cycle (TCA cycle)
amd00310  Lysine degradation
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
Module
amd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMED_2168 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    AMED_2168 (sucB)
Enzymes [BR:amd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AMED_2168 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H TonB_N HlyD_3 RnfC_N Trypan_PARP
Motif
Other DBs
NCBI-GeneID: 9436381
NCBI-ProteinID: YP_003764373
UniProt: A0A0H3D348
Position
complement(2322514..2324307)
Genome map
AA seq 597 aa AA seqDB search
MAYSVTLPELGESVTEGTVTRWLKQEGDTVEVDEPLLEISTDKVDTEVPSPVAGTVVKIS
AQEDETVEVGGELAVIDDGTGGVPESSSSSAAPAQEEQQESEPEPEQSSEPEPQAEDSAP
SKPDTAPAAGGEGTEVKLPELGESVTEGTVTRWLKAVGDSVEVDEPLLEISTDKVDTEVP
SPVAGTVLEIRAGEDETVEVGGVLAVIGDAGAAPKAESKPEPKPEPKPEPQPEPKPEPVQ
EAKPEPKPEPKPEPQAAPAAKAAEAAPAAAAKDGSADGPYVTPLVRKLASEHGIDLASLT
GSGVGGRIRKQDVLAAAEEKQKAAAAPAPAAAAPAAAAAPAAPAARPAAAVSPELAALRG
TVQKASRIRQITATKTRESLQIAAQLTQVQEVDVTKIAKLRQRAKAGFKEREGVNLTFLP
FFAKATVEALKQHPNVNASYNEDTKEITYHGAVHLGIAVDTERGLLSVVIHDAGELSLAG
LAHRIADLAGRARAGQIKPDELSGGTFSITNIGSVGALFDTPIIVQPQSGILGTGAVVKR
PVVIADADGNDTIAVRSMAYLPLTYDHRLVDGADAGRFLTTIKQRLEEGNFESELGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcctactccgtcacattgccggagctcggggagagcgtcaccgaaggcaccgtcacc
cggtggcttaagcaggagggcgacaccgtcgaggtcgacgagccgttgctcgagatctcg
accgacaaggtcgacaccgaggtgccctccccggtggcgggcacggtcgtgaagatcagc
gcccaggaggacgagaccgtcgaggtcggcggcgagctcgccgtcatcgacgacggcacc
ggcggcgtgccggagtcctcttcttcttccgccgccccggcccaggaagagcagcaggag
tccgagccggagccggagcagtcgtccgagcccgagccgcaggccgaggacagcgcgccg
agcaagccggacaccgcgccggccgccggtggcgaaggcaccgaggtgaaactgcccgag
ctgggcgagagcgtcaccgagggcaccgtcacgcgctggctgaaggcggtcggcgactcg
gtcgaggtcgacgagccgctgctcgagatctccaccgacaaggtcgacaccgaggtgccg
tcgccggtcgccggcacggtgctggagatccgcgcgggcgaggacgagaccgtcgaggtc
ggcggcgtcctggccgtgatcggcgacgccggtgcggcgccgaaggcggagtcgaagccg
gagcccaagcccgagccgaagccggaaccccagccggagccgaagcccgagccggttcag
gaggccaagcccgagcccaagccggaaccgaagcccgagccgcaggccgcccccgcggcc
aaggcggccgaagcggccccggccgccgcggcgaaggacggttcggcggacggcccgtac
gtcacgccgctggtccgcaagctcgcgtcggagcacggcatcgacctcgcgtcgctgacc
ggcagcggcgtcggcggccggatccgcaagcaggacgtcctggccgcggccgaggagaag
cagaaggccgccgccgctccggcgccggccgcggccgctccggctgccgccgctgccccg
gcggcgcccgccgcgcgtccggcggccgcggtgtcgccggaactggccgcgctgcgcggc
accgtgcagaaggccagccggatccgccagatcacggccaccaagacccgcgagtcgctg
cagatcgccgcgcagctcacgcaggtccaggaggtcgacgtcacgaagatcgccaagctg
cggcagcgggcgaaggcgggcttcaaggagcgcgagggcgtcaacctgacgttcctgccg
ttcttcgcgaaggccacggtcgaggcgctcaagcagcacccgaacgtcaacgcgtcctac
aacgaggacacgaaggagatcacctaccacggcgccgtgcacctgggcatcgcggtggac
accgagcgcgggctgctctcggtcgtgatccacgacgcgggcgagctgagcctggccggt
ctcgcgcaccggatcgccgacctggcgggccgcgcgcgggcgggccagatcaagccggac
gagctgtcgggcggcaccttctcgatcacgaacatcggcagcgtcggcgcgttgttcgac
acgccgatcatcgtgcagccgcagtcgggcattctcggcaccggcgcggtcgtcaagcgc
ccggtggtgatcgcggacgccgacggcaacgacacgatcgccgtccggtcgatggcgtac
ctcccgctgacctacgaccaccgcctggtggacggggccgacgcgggccgcttcctgacg
acgatcaagcagcgcctggaagagggcaacttcgagagcgaactcggcctctga

DBGET integrated database retrieval system