KEGG   Amycolatopsis mediterranei U32: AMED_2269Help
Entry
AMED_2269         CDS       T01269                                 

Gene name
hisH
Definition
glutamine amidotransferase HisH
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amd01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:amd00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2422555..2423172
Genome map
AA seq 205 aa AA seqDB search
MVILDYGSGNLRSAERAVARAGADVEVTADPHAAVEADGLVVPGVGAYSACMAGLLDVQG
HRIIGKRLAGGRPVLGICVGMQILFARGVEHGEETEGTGEWPGVVDRLHADVLPHMGWNT
VRAPADSRLFAGLDPEERFYFVHSYAARTWELDGLAGQEPKVTWAHHGEDFVAAVENGPL
WATQFHPEKSGDAGAQLLRNWLATL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcctcgactacggttccggcaacctccgctccgccgaacgcgctgtggcgcgc
gccggggccgacgtcgaggtcaccgccgacccgcatgccgccgtcgaagccgatgggctc
gtcgtgcccggcgtcggtgcctactccgcctgcatggcggggctgctggacgtgcagggg
caccggatcatcgggaagcggctcgccggcggccgcccggtgctcggcatctgcgtcggc
atgcagatcctcttcgcccgcggggtcgagcacggcgaggagaccgaaggcaccggggaa
tggcccggggtcgtcgaccggctgcacgcggatgtcctgccgcacatggggtggaacacc
gtgcgcgcgcccgcggactcgcggctgttcgccggtctcgaccccgaggagcggttctac
ttcgtgcactcctacgccgcgcgcacgtgggagctcgacggcctggccgggcaggaaccg
aaggtcacctgggcccaccacggcgaagacttcgtcgccgcggtcgaaaacgggccgctg
tgggccacccagttccacccggaaaagtccggtgacgccggggcgcagctgctgcgcaac
tggctggcgaccctctga

DBGET integrated database retrieval system