KEGG   Amycolatopsis mediterranei U32: AMED_2293Help
Entry
AMED_2293         CDS       T01269                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amd01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:amd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2439338..2440147
Genome map
AA seq 269 aa AA seqDB search
MSVLEDIVAGVREDLAVRESALPFDELKIRAAAAPAPRDVMAALRESGIGVIAEVKRRSP
SKGDLADIPDPAALAKDYEAGGARVISVLTEQRRFGGSLADLDAVRAAVDIPILRKDFVV
SPYQVHEARLHGADMVLLIVAALEQNALVSLLDRVESLGMTALVEIHNAEEADRALEAGA
KVIGVNARNLHTLEVDRDVFSRLAPGLPMDVYKVAESGVRGPGDLMSYAGHGADAVLVGE
GLVASGDPKGALVKLVTAGSHPACPRPSR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgctcgaagacatcgtcgccggcgtgcgggaagatctcgccgtgcgggaatcc
gcgctgccgttcgacgagctgaagatccgcgcggccgccgccccggcgccgcgcgacgtg
atggccgccctgcgcgagtccggcatcggcgtgatcgccgaagtcaagcggcgcagccct
tcgaagggcgacctggccgacatccccgacccggccgcgctggcgaaggactacgaagcc
ggcggggcgcgcgtgatcagcgtgctcaccgagcagcgccgcttcggcggttcgctggcc
gacctggacgcggtccgcgcggcggtggacatccccatcctgcgcaaggacttcgtcgtc
agcccctaccaggtgcacgaggcccgcctgcacggcgccgacatggtgctgctgatcgtc
gccgcgctggagcagaacgcgctcgtctcgctgctcgaccgcgtcgaatcgctcggcatg
accgcgctggtggagatccacaacgccgaggaggccgaccgggccctcgaggcgggcgcc
aaggtcatcggcgtcaacgcgcgcaacttgcacaccctcgaggtggaccgggacgtcttc
tcgcggctggcccccggcctgccgatggacgtctacaaggtcgccgagtccggtgtccgc
ggcccgggcgacctgatgtcctacgccggccacggcgccgacgcggtgctggtcggcgag
gggctcgtcgcctccggcgacccgaagggcgccctggtcaagctggtcaccgccggttcc
caccccgcctgcccgaggccgtcccggtga

DBGET integrated database retrieval system