KEGG   Amycolatopsis mediterranei U32: AMED_2294Help
Entry
AMED_2294         CDS       T01269                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00260  Glycine, serine and threonine metabolism
amd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01130  Biosynthesis of antibiotics
amd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMED_2294 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMED_2294 (trpB)
Enzymes [BR:amd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMED_2294 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 9436501
NCBI-ProteinID: YP_003764493
UniProt: A0A0H3D3F9
Position
2440144..2441355
Genome map
AA seq 403 aa AA seqDB search
MTQEHDKHDPDERGYYGPYGGRFMPEALIGVVDEVATEYDKARHDPEFLNEFNRLLRDYA
GRPSLLTEAKRFGEHAGGARVFLKREDLNHTGSHKINNVLGQALLTKRMGKKRVIAETGA
GQHGVATATACALLDLDCVVYMGEVDTERQALNVARMRLLGAEVIPVKTGSRTLKDAINE
ALRDWVTNADTTHYLFGTAAGPAPFPTMVRNFHHVIGTEAREQILEQAGRLPDVVAACVG
GGSNAIGIFSGFYDDPSVRLVGLEPGGEGIEGNRHGATLTKGTPGNLHGAMTYLLQDDDG
QTVESHSISAGLDYPGVGPEHAWLKDTGRAEYRPITDAQAMDAFKLLSRTEGIIPAIESA
HALAGALDLGRELGPEGLIVVNLSGRGDKDMDTAAKWFGLVNG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggagcacgacaagcacgacccggacgagcgcggctactacggcccgtacggg
ggccggttcatgccggaggcgctgatcggcgtcgtcgacgaggtcgccaccgagtacgac
aaggcccggcacgacccggagttcttgaacgagttcaaccgcttgcttcgcgattacgcg
ggccgcccgtcgctgctcaccgaggccaagcgcttcggcgagcacgccggcggcgcgcgg
gtgttcctcaagcgcgaggacctgaaccacaccggctctcacaagatcaacaacgtgctg
ggtcaggcgctgctcaccaagcggatgggcaagaagcgcgtcatcgccgagaccggcgcg
ggccagcacggcgtcgcgacggccaccgcgtgcgcgctgctcgaccttgattgcgtcgtc
tacatgggcgaggtcgacaccgagcgccaggcgctgaacgtggcccgcatgcggctgctc
ggcgccgaggtgatcccggtcaagaccgggtcgcggacgctgaaggacgcgatcaacgag
gcgctgcgcgactgggtcaccaacgccgacaccacgcactacctcttcggcacggccgcc
gggccggcgccgttcccgacgatggtgcgcaacttccaccacgtcatcggcaccgaggcc
cgcgagcagatcctcgagcaggccgggcgcctgcccgacgtcgtcgcggcctgcgtcggc
ggcgggtcgaacgcgatcggcatcttctccggcttctacgacgacccgtccgtgcggctg
gtcggcctggagccgggcggcgagggcatcgagggcaaccgccacggcgccaccctgacc
aagggcaccccgggcaacctgcacggcgcgatgacgtacctgctgcaggacgacgacggc
cagacggtcgagtcgcactcgatctcggccgggctcgactacccgggcgtcggcccggag
cacgcgtggctcaaggacaccggccgcgccgagtaccgcccgatcaccgacgcccaggcg
atggacgcgttcaagctgctgtcccgcaccgaaggcatcatcccggcgatcgagtcggcg
cacgcgctggccggcgcgctggacctgggccgcgaactgggtcctgaaggattgatcgtg
gtgaatttgtctggccgcggcgacaaggacatggacacggcggccaagtggttcggactg
gtgaacggatga

DBGET integrated database retrieval system