KEGG   Amycolatopsis mediterranei U32: AMED_2294Help
Entry
AMED_2294         CDS       T01269                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMED_2294 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMED_2294 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMED_2294 (trpB)
Enzymes [BR:amd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMED_2294 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2440144..2441355
Genome map
AA seq 403 aa AA seqDB search
MTQEHDKHDPDERGYYGPYGGRFMPEALIGVVDEVATEYDKARHDPEFLNEFNRLLRDYA
GRPSLLTEAKRFGEHAGGARVFLKREDLNHTGSHKINNVLGQALLTKRMGKKRVIAETGA
GQHGVATATACALLDLDCVVYMGEVDTERQALNVARMRLLGAEVIPVKTGSRTLKDAINE
ALRDWVTNADTTHYLFGTAAGPAPFPTMVRNFHHVIGTEAREQILEQAGRLPDVVAACVG
GGSNAIGIFSGFYDDPSVRLVGLEPGGEGIEGNRHGATLTKGTPGNLHGAMTYLLQDDDG
QTVESHSISAGLDYPGVGPEHAWLKDTGRAEYRPITDAQAMDAFKLLSRTEGIIPAIESA
HALAGALDLGRELGPEGLIVVNLSGRGDKDMDTAAKWFGLVNG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggagcacgacaagcacgacccggacgagcgcggctactacggcccgtacggg
ggccggttcatgccggaggcgctgatcggcgtcgtcgacgaggtcgccaccgagtacgac
aaggcccggcacgacccggagttcttgaacgagttcaaccgcttgcttcgcgattacgcg
ggccgcccgtcgctgctcaccgaggccaagcgcttcggcgagcacgccggcggcgcgcgg
gtgttcctcaagcgcgaggacctgaaccacaccggctctcacaagatcaacaacgtgctg
ggtcaggcgctgctcaccaagcggatgggcaagaagcgcgtcatcgccgagaccggcgcg
ggccagcacggcgtcgcgacggccaccgcgtgcgcgctgctcgaccttgattgcgtcgtc
tacatgggcgaggtcgacaccgagcgccaggcgctgaacgtggcccgcatgcggctgctc
ggcgccgaggtgatcccggtcaagaccgggtcgcggacgctgaaggacgcgatcaacgag
gcgctgcgcgactgggtcaccaacgccgacaccacgcactacctcttcggcacggccgcc
gggccggcgccgttcccgacgatggtgcgcaacttccaccacgtcatcggcaccgaggcc
cgcgagcagatcctcgagcaggccgggcgcctgcccgacgtcgtcgcggcctgcgtcggc
ggcgggtcgaacgcgatcggcatcttctccggcttctacgacgacccgtccgtgcggctg
gtcggcctggagccgggcggcgagggcatcgagggcaaccgccacggcgccaccctgacc
aagggcaccccgggcaacctgcacggcgcgatgacgtacctgctgcaggacgacgacggc
cagacggtcgagtcgcactcgatctcggccgggctcgactacccgggcgtcggcccggag
cacgcgtggctcaaggacaccggccgcgccgagtaccgcccgatcaccgacgcccaggcg
atggacgcgttcaagctgctgtcccgcaccgaaggcatcatcccggcgatcgagtcggcg
cacgcgctggccggcgcgctggacctgggccgcgaactgggtcctgaaggattgatcgtg
gtgaatttgtctggccgcggcgacaaggacatggacacggcggccaagtggttcggactg
gtgaacggatga

DBGET integrated database retrieval system