KEGG   Amycolatopsis mediterranei U32: AMED_2295Help
Entry
AMED_2295         CDS       T01269                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMED_2295 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMED_2295 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMED_2295 (trpA)
Enzymes [BR:amd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMED_2295 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2441352..2442143
Genome map
AA seq 263 aa AA seqDB search
MSGLDDLFAATRAEGRAALIGYLPAGFPTVEGSKDLIAACVDGGADLIEVGVPYSDPVMD
GPTIQAASVTALDNGFRLKHVFEVVESISARGGRAVVMTYWNPVNRYGVDRFARDLASAG
GLGLITPDLIPDEAGAWIAASETHGLDRTFLVAPSSSEERLALTAAASSGFIYATAVMGV
TGARDQVGAGAEELVRRTRVHTSLPIGVGLGVRSGDQAAEVASFADAVIVGSALVTAAAE
GSSGVRALSAELAEGVRRAVATA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggctcgacgacctcttcgccgcgacgcgcgccgaggggcgcgccgcgctgatc
ggctacctcccggcgggcttccccacggtcgagggctcgaaggacctgatcgcggcctgc
gtcgacggcggcgcggacctgatcgaggtcggcgtcccgtattcggacccggtgatggac
ggcccgaccatccaggccgcctcggtgaccgcgctggacaacgggttccgcctcaagcac
gtgttcgaggtcgtcgagtcgatctcggcccgcggcggccgtgcggtcgtgatgacgtac
tggaacccggtgaaccgctacggcgtggaccgcttcgcgcgtgacctcgcctcggcgggc
gggctcggcctgatcacgccggacctgatcccggacgaggccggcgcgtggatcgcggca
tcggagacccacggcctggaccgcaccttcctggtggcgccttcgtcgtcggaagagcgg
ctcgcgttgacggcggcggcgtcgtcgggcttcatctacgcgaccgcggtgatgggcgtg
acgggcgcgcgcgaccaggtcggagccggagcggaggagctggtgcgccgcacgcgagtg
cacacttcgcttccgatcggcgtgggcctgggtgtccggtcgggcgaccaggcggccgag
gtggcgtccttcgcggacgcggtgatcgtgggctcggccctggtcacggcggcggccgaa
ggctcgtcgggcgttcgtgccctgtcggccgagctggccgagggcgtgcgccgggcggtc
gccaccgcttga

DBGET integrated database retrieval system