KEGG   Amycolatopsis mediterranei U32: AMED_2300Help
Entry
AMED_2300         CDS       T01269                                 

Gene name
glnA3-1
Definition
glutamine synthetase
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMED_2300 (glnA3-1)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AMED_2300 (glnA3-1)
  Energy metabolism
   00910 Nitrogen metabolism
    AMED_2300 (glnA3-1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_2300 (glnA3-1)
   00330 Arginine and proline metabolism
    AMED_2300 (glnA3-1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMED_2300 (glnA3-1)
Enzymes [BR:amd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     AMED_2300 (glnA3-1)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMED_2300 (glnA3-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2445399..2446781)
Genome map
AA seq 460 aa AA seqDB search
MNSDGGRMSQLDRAELAQQGALRADGLRAAGVELVALTFVDNSGIARVKAVPVDRLWSAA
AWGVGASNSFDFFLATDDIVDGTHSRGPVGDLRLHPDLDALVPLAAQPGWAWAPAWRYDQ
EGAPHPQDARALAAAATARLAELGYNARTAFEIEWVITAADAPDDPRSATAGPAYGYARL
SSQAGYLRKLVSTLTAQGVAVEQIHPEYAAGQFEVSVAAGDPVRAADVAVLTRETIRTVS
EQYGLRASFTPKFAPDGVGNGGHVHLSLWDGDRNLCAGGDRRFGLTETAEAFGAGIFSRL
PALLAIGAPSVVSYLRLEPHHWAGVFRVWGLENREAPLRLVRGPAGQRERAANFEVKCFD
LTANPYLVVAALIFAGLAGVEARESLPEPVDVDPGTLGGAVERLPTSLAEAVAAFEADPA
LTTAFGPELATTLVDVRRGELDRLGALPPDELCAVMRYLH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgaacagcgacgggggcaggatgagccagctcgatcgggcggaactcgcacaacaaggc
gcactgcgggccgacggcctgcgcgctgccggcgtggagctcgtcgcgctgaccttcgtg
gacaacagcggcatcgcgcgggtgaaagccgtgccggtggaccggctgtggtcggcggcg
gcgtggggcgtcggcgcgtcgaactcgttcgacttcttcctggccaccgacgacatcgtg
gacggcacgcattcgcgcggcccggtcggcgacctgcggctgcacccggacctcgacgcg
ctcgtgccgctggccgcgcagccgggctgggcgtgggcgccggcgtggcggtacgaccag
gaaggcgcgccgcacccgcaggacgcgcgggcgctggccgcggccgcgacggcccggctc
gcggagctgggctacaacgcgcggacggcgttcgagatcgagtgggtgatcacggcggcc
gacgcgccggacgacccgcgctcggccaccgcgggccccgcctacggctacgcgcggctt
tcctcgcaggcgggctacctgcgcaagctggtgtccacgttgaccgcccagggggtcgcg
gtggagcagatccacccggagtacgcggcggggcagttcgaggtgtcggtggcggccggt
gacccggtgcgcgcggcggacgtggcggtgctgacgcgggagacgatccggacggtcagc
gagcagtacgggctgcgggcgtcgttcacgccgaagttcgcgccggacggcgtcggcaac
ggcggtcacgtccacctgagcctgtgggacggcgaccgcaacctgtgcgccggcggcgat
cggcggttcgggctcacggagacggcggaggcgttcggcgccggcatcttctcgcggctg
ccggcgctgctggcgatcggcgcgccctcggtggtcagctacctgcggctcgagccgcac
cactgggccggggtgttccgggtgtggggcctggaaaaccgcgaggcgccgctgcggctg
gtccggggtccggccgggcagcgcgagcgggcggcgaacttcgaggtcaagtgcttcgac
ctgaccgcgaacccctacctggtggtggcggcgctgatcttcgcgggcctggccggggtc
gaggcccgggagagcctgccggagccggtcgacgtcgaccccggaacgctcgggggtgcg
gttgagcggctgccgacgtcgctggccgaagcggtggcggcgttcgaagcggacccggcg
ttgacgacggcgttcggccccgagctggcgacgacgctggtggacgtccgccgcggcgag
ctcgaccggctcggcgccctgccgccggacgagctgtgcgccgtgatgcggtacctccat
tga

DBGET integrated database retrieval system