KEGG   Amycolatopsis mediterranei U32: AMED_2451Help
Entry
AMED_2451         CDS       T01269                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00010  Glycolysis / Gluconeogenesis
amd00052  Galactose metabolism
amd00500  Starch and sucrose metabolism
amd00520  Amino sugar and nucleotide sugar metabolism
amd00521  Streptomycin biosynthesis
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_2451 (glk)
   00052 Galactose metabolism
    AMED_2451 (glk)
   00500 Starch and sucrose metabolism
    AMED_2451 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AMED_2451 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AMED_2451 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AMED_2451 (glk)
Enzymes [BR:amd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AMED_2451 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase
Motif
Other DBs
NCBI-GeneID: 9436657
NCBI-ProteinID: YP_003764649
UniProt: A0A0H3D1X2
Position
2614306..2615244
Genome map
AA seq 312 aa AA seqDB search
MDVGGTSIRAGVVDERGSLLDTARVATPTEEGALEDAIAGVVEDLRNRHDVAGVGLAVAG
FVARDRRSVMFAPHLAWRGAPVADRIEKRVGLPVLLEHDVNSAIVGEHRFGAARGAQVAA
LVALGTGIGAGLLLDGKLYRGAYGVAPELGHLTVVRGGRPCPCGKYGCWERYCSGTALAA
TAVELLARHPGRSTVLAPQVAGDPGSVTGRRVAGAARDGDPIAQLAMAELAKWLGEGLAL
VADVFDPEIIVIGGGVSESAPLFLDEAREHYAATITGARHRPLARIRTAHLGDDTAIVGA
AALALEAAKTPV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtcggcgggacgagcatccgggccggcgtggtggacgaacgcggctccctgctc
gacacggcccgcgtcgcgacgccgaccgaggaaggcgccctcgaggacgccatcgccggc
gtggtcgaggacctgcgcaaccggcacgacgtggccggggtcgggctggcggtggcgggc
ttcgtcgcgcgcgaccgccggtcggtgatgttcgccccgcacctggcgtggcgcggcgcc
ccggtcgccgaccggatcgaaaagcgcgtcggcctgccggtgctgctggagcacgacgtc
aattcggcgatcgtcggcgagcaccgcttcggcgcggcccgcggcgcccaggtggcggcc
ctggtggccctgggcacgggcatcggcgcgggactgttgctggacggcaagctgtatcga
ggcgcgtacggcgtcgcgccggagctgggccacctgacggtggtccgcggcggccgcccc
tgcccgtgcggcaagtacggttgctgggagcggtactgcagcggaacggccctggcggcc
acggcggtggagctgctggcgcggcacccgggccgctcgacggtgctggccccccaggtc
gcgggcgacccgggctcggtgacgggccgccgggtggcgggcgcggcccgcgacggcgac
ccgatcgcccagctggcgatggcggaactggccaagtggctgggtgagggcttggcgctg
gtggcggacgtgttcgacccggagatcatcgtgatcggcggcggggtgtcggagtcggcc
ccgctgttcctggacgaggcccgcgagcactacgcggccacgatcacgggcgcccgccac
cggccgctggcccgcatcaggacggcccacctcggcgacgacacggcgatcgtcggtgca
gcggccctggccctggaagcggcgaagaccccggtctga

DBGET integrated database retrieval system