KEGG   Amycolatopsis mediterranei U32: AMED_2481Help
Entry
AMED_2481         CDS       T01269                                 

Gene name
paaG
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    AMED_2481 (paaG)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMED_2481 (paaG)
   00650 Butanoate metabolism
    AMED_2481 (paaG)
  Lipid metabolism
   00071 Fatty acid degradation
    AMED_2481 (paaG)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMED_2481 (paaG)
   00310 Lysine degradation
    AMED_2481 (paaG)
   00360 Phenylalanine metabolism
    AMED_2481 (paaG)
   00380 Tryptophan metabolism
    AMED_2481 (paaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMED_2481 (paaG)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMED_2481 (paaG)
   00281 Geraniol degradation
    AMED_2481 (paaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMED_2481 (paaG)
   00627 Aminobenzoate degradation
    AMED_2481 (paaG)
   00930 Caprolactam degradation
    AMED_2481 (paaG)
Enzymes [BR:amd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMED_2481 (paaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2643577..2644383)
Genome map
AA seq 268 aa AA seqDB search
MEDTSITSGAAVSRNVLVQRDGAVTTITIDRPAARNAVDGPTAAELADAFRVFDADPDAA
VAVLTGAGGAFCAGADLKAIGTDRVNRTHPDGDGPMGPTRMTLGKPVIAAVHGPAVAGGL
ELALWCDLRVADATAVFGVFCRRWGVPLIDGGTVRLPRLIGQSRAMDLILTGRPVDAAEA
VEIGLANRLVPAGEAVTAAQELARQLAAFPQACLRGDRRSALAQWGESEEDALAAEFAAA
MGEGVLAAEAVEGAARFTDGEGRHGTFT
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtggaagacacctcgatcacctcaggagcggccgtgtcccggaacgtgctggtgcagcgg
gacggcgcggtgacgacgatcaccatcgaccgcccggccgcgcgcaacgccgtcgacggg
cccacggcggcggagctggccgacgccttccgcgtgttcgacgccgacccggacgcggcc
gtcgcggtgctcaccggagccggcggcgcgttctgcgcgggagccgatctcaaggcgatc
ggcaccgaccgggtgaaccgcactcacccggacggggacggcccgatgggaccgacccgg
atgaccctcggcaagccggtgatcgcggcggtccacgggccggccgtcgcgggcgggctc
gagctcgcgctgtggtgcgacctgcgcgtcgccgacgccacggcggtgttcggcgtgttc
tgccgccgctggggcgtcccgctgatcgacggcggaacggtgcggctgccgcgcctgatc
ggccagtcgcgcgcgatggacctgatcctcaccggccggccggtcgacgccgccgaggcc
gtcgagatcggcttggccaaccggctggtgccggccggcgaggcggtgacggcggcgcag
gagctggcccggcagctcgcggccttcccccaggcctgcctgcgcggcgaccgccgctcg
gcgctggcccagtggggcgagtccgaagaggacgcactggcggccgagttcgccgcggca
atgggcgagggcgtcctggcagcggaggcggtcgaaggcgcggcccgcttcaccgacggc
gagggccgccacggcaccttcacgtga

DBGET integrated database retrieval system