KEGG   Amycolatopsis mediterranei U32: AMED_2591Help
Entry
AMED_2591         CDS       T01269                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMED_2591 (malQ)
Enzymes [BR:amd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AMED_2591 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2762801..2764756
Genome map
AA seq 651 aa AA seqDB search
MPEEIPARSALHELADLHGVATRYQNADRVWVDVDDDVVVAVLGQFGVDATGDQAIAAAL
SAAREAPAALPPTIVVREGTGKALGVDAEVVLEDGTRRRADGHLPADLPLGWHRVVTADQ
DVVLAVVPAKLPRVPPAWGWMLQLYALHSAGSWGIGDYADLATFAARSAAELDAGVLLVN
PVQAISPAHPIERSPYSPASRRFANPVYLRVTATETFEQADEATRAAVESLAPEREGELI
DYDAVWTAKRAALELLWPHRVEEVPEDGDLRAFALFCALAEQHGADWRDWPEDLHDPAGA
ATAKAREELEDRVAFHAWLQHLCRVQLEAARTAARGAGMTAGIVHDLPVGVHPGGADTWA
VRDVFAADVRVGAPPDAFNQQGQDWNLPPWRPDKLAEAGYAPFRDVIRGVLRFADGIRVD
HIAGLWRLWWIPPGEPAHRGTYVHYDAEAMVGVLALEAHRAGAIVVGEDLGTVEEVVTDT
MHERGMLSSAVLWFERDWDAPGQPFTPPESWDPDAMASISTHDLPTVSGWLKSEHVRVRA
ELGLLDRGVEAEEEAAAGERKALLELVAREGIPGDDPVVALHTLLAKAASRLVLTSPADV
AGQVRQPNLPGTVDQYPNWRIRLPVSVDGFFTAQGVRAAVAPLAAARPLPR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaagagatccccgcccgcagcgccctgcacgagctcgccgacctccacggggtc
gccacccggtaccagaacgccgatcgggtctgggtcgacgtggacgacgacgtcgtcgtc
gccgtcctcggccagttcggcgtcgatgcgaccggcgaccaggccatcgccgccgctctg
agcgccgcgcgggaggcgccggccgcgctgccgccgaccatcgtcgtgcgggagggcacc
ggcaaggcgctgggcgtcgacgccgaagtcgtcctcgaggacgggacgcggcggcgcgcc
gacggtcacctgcccgcggacctgccgctcggctggcaccgggtcgtcaccgccgaccag
gacgtcgtgctggccgtggtgccggcgaagctgccgcgagtcccgcccgcctgggggtgg
atgctgcagctctacgccctgcactcggccgggtcctggggcatcggcgactacgccgac
ctcgccaccttcgccgcccggtcggccgcggaactggatgccggcgtcctgctggtgaac
ccggtgcaggcgatcagccccgcgcacccgatcgaacgatcgccgtactcgccggcaagc
cggcggttcgccaacccggtctacctgcgcgtcacggccaccgagacgttcgaacaggcc
gacgaggcgacccgggcggccgtcgagtccctggccccggagcgcgaaggcgagctgatc
gactacgacgccgtctggaccgccaagcgggccgcgctcgagctgctgtggccgcaccgc
gtcgaagaggtgcccgaagacggcgacctgcgcgctttcgccctcttctgcgccctggcc
gagcagcacggcgccgactggcgggactggccggaggacctgcacgacccggccggagcg
gccaccgcaaaggcgcgcgaagagctcgaagaccgcgtcgccttccacgcgtggctccag
cacctctgccgggttcagctggaagcggcgcggacggctgcgcgcggggccgggatgacc
gccgggatcgtgcacgacctgccggtgggggtgcaccccggcggggccgacacgtgggcc
gtgcgggacgtcttcgccgccgacgtgcgggtcggcgccccacccgacgccttcaaccag
cagggccaggactggaacctgccgccgtggcggccggacaagctggccgaggccgggtac
gcgccgttccgggacgtcatccggggcgtcctgcgcttcgccgacggcatccgcgtcgac
cacatcgccggcctgtggcggctctggtggatcccgccgggcgagcccgcgcaccgcggc
acgtacgtccattacgacgccgaagcgatggtcggcgtgctcgcgctcgaagcgcaccgc
gccggggccatcgtggtgggggaggacctcgggaccgtcgaggaggtcgtcaccgacacc
atgcacgaacgggggatgctcagctcggccgtgctgtggttcgagcgcgactgggacgcg
cccggccagccgttcacaccgccggagagctgggacccggacgccatggccagcatctcc
acgcacgacctgccgacggtgtcgggctggctgaagagcgagcacgtccgggtccgggcc
gagctgggactgctggaccgcggggtcgaagccgaggaagaagcggccgccggcgagcgc
aaggcgctgctggaactcgttgcccgggaagggatccccggcgacgacccggtcgtcgcg
ctgcacaccctgctcgcgaaggccgcttcgcggctcgtgctgacctcgccggccgacgtc
gcgggccaggtgcggcagccgaatctgcccggaaccgtcgaccagtaccctaactggcgg
attcgcctgcccgtcagcgtggacggcttcttcaccgcgcagggggtccgcgcagcggtc
gcaccgctggcggcggcccggccgctgccccggtaa

DBGET integrated database retrieval system