KEGG   Amycolatopsis mediterranei U32: AMED_2602Help
Entry
AMED_2602         CDS       T01269                                 

Gene name
ppgK
Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:amd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:amd00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:amd00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2783162..2783929)
Genome map
AA seq 255 aa AA seqDB search
MVEATRRGFGIDIGGSGIKGALVDLDSGQLIGDRIRIETPKPSTPSAVADVVHDVVTQAG
WDGPVGVTLPAVVKKGVAHTAANIDKQWIGTDADALFAKRLGRSVDQVAMLNDADAAGMA
EIRFGDPVARTGVTALLTFGTGIGSAVFQDGKLVPNTEFGHLEIDGHDAEKRAAASVKDN
EGLSYPEWAKRVHRYLTVLENLIWPDLFIVGGGVSKKAEKWVPLLDIRTPVLVASLQNNA
GIVGAAAAAAEGIQH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtggtggaggcgacccgccgaggtttcggcatcgacatcggcggcagcgggatcaagggc
gccttggtcgacctggactccggccagctcatcggcgaccgcatccggatcgagacgccg
aaaccgtccacgccgtcggcggtggcggacgtcgtgcacgacgtcgtcacgcaggcgggc
tgggacggcccggtcggcgtgaccctgccggcggtcgtcaagaagggcgtcgcgcacacc
gcggccaacatcgacaagcagtggatcggcaccgacgccgacgcgctgttcgccaagcgg
ctcggccggagcgtcgaccaggtcgcgatgctgaacgacgccgacgcggcgggcatggcg
gagatccgcttcggcgacccggtcgcgcgcacgggcgtgacggcgctgctcaccttcggc
accggcatcggcagcgcggtgttccaggacggcaagctcgtccccaacaccgaattcggc
cacctcgagatcgacggccacgacgccgagaagcgcgcggccgcttcggtgaaggacaac
gaggggctctcctaccccgaatgggccaagcgcgtgcaccgttacctgaccgtgctggag
aacctgatctggcccgacctgttcatcgtcggcggcggcgtcagcaagaaggccgagaaa
tgggtgccgctgctggacatccgcactccggtgctggtggcgagcctgcagaacaacgcc
gggatcgtcggcgccgcggccgccgcggcggagggcatccagcactga

DBGET integrated database retrieval system