KEGG   Amycolatopsis mediterranei U32: AMED_2602Help
Entry
AMED_2602         CDS       T01269                                 

Gene name
ppgK
Definition
(RefSeq) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00010  Glycolysis / Gluconeogenesis
amd00520  Amino sugar and nucleotide sugar metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_2602 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    AMED_2602 (ppgK)
Enzymes [BR:amd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     AMED_2602 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 9436807
NCBI-ProteinID: YP_003764799
UniProt: A0A0H3D299
Position
complement(2783162..2783929)
Genome map
AA seq 255 aa AA seqDB search
MVEATRRGFGIDIGGSGIKGALVDLDSGQLIGDRIRIETPKPSTPSAVADVVHDVVTQAG
WDGPVGVTLPAVVKKGVAHTAANIDKQWIGTDADALFAKRLGRSVDQVAMLNDADAAGMA
EIRFGDPVARTGVTALLTFGTGIGSAVFQDGKLVPNTEFGHLEIDGHDAEKRAAASVKDN
EGLSYPEWAKRVHRYLTVLENLIWPDLFIVGGGVSKKAEKWVPLLDIRTPVLVASLQNNA
GIVGAAAAAAEGIQH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtggtggaggcgacccgccgaggtttcggcatcgacatcggcggcagcgggatcaagggc
gccttggtcgacctggactccggccagctcatcggcgaccgcatccggatcgagacgccg
aaaccgtccacgccgtcggcggtggcggacgtcgtgcacgacgtcgtcacgcaggcgggc
tgggacggcccggtcggcgtgaccctgccggcggtcgtcaagaagggcgtcgcgcacacc
gcggccaacatcgacaagcagtggatcggcaccgacgccgacgcgctgttcgccaagcgg
ctcggccggagcgtcgaccaggtcgcgatgctgaacgacgccgacgcggcgggcatggcg
gagatccgcttcggcgacccggtcgcgcgcacgggcgtgacggcgctgctcaccttcggc
accggcatcggcagcgcggtgttccaggacggcaagctcgtccccaacaccgaattcggc
cacctcgagatcgacggccacgacgccgagaagcgcgcggccgcttcggtgaaggacaac
gaggggctctcctaccccgaatgggccaagcgcgtgcaccgttacctgaccgtgctggag
aacctgatctggcccgacctgttcatcgtcggcggcggcgtcagcaagaaggccgagaaa
tgggtgccgctgctggacatccgcactccggtgctggtggcgagcctgcagaacaacgcc
gggatcgtcggcgccgcggccgccgcggcggagggcatccagcactga

DBGET integrated database retrieval system