KEGG   Amycolatopsis mediterranei U32: AMED_2644Help
Entry
AMED_2644         CDS       T01269                                 

Gene name
hemY
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00860  Porphyrin and chlorophyll metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
Module
amd_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMED_2644 (hemY)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AMED_2644 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     AMED_2644 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 Pyr_redox_2 NAD_binding_9 HI0933_like Trp_halogenase Pyr_redox FMO-like NAD_binding_7 MCRA
Motif
Other DBs
NCBI-GeneID: 9436849
NCBI-ProteinID: YP_003764841
UniProt: A0A0H3D0L0
Position
2832078..2833478
Genome map
AA seq 466 aa AA seqDB search
MKRVAVVGGGVSGLTAAYRLRQLLGPEAEITVYEKTTAPGGKLRTAELAGVPYDVGAEAF
LVRRPEMLALARELGLDVVHPTKARAKIHAGGAVTGLPPGTVMGVPASAESVAGVLSETG
RQAVEAEPLLPELRLPGGDVPLGPLLRERFGDELVDRLVDPLLGGVYAGGADGLGLRATM
PGLASALAAGAGSLTAAAAAQLPANPSTAPVFGTVPGGLGTVIDRLTTASGAQLRTGLPV
CEIERHGDGWRLCIGAAPTAHAPADNLAEADAVVLAVPAPSARRLLTDLVPAASAAFGEV
ELASMAVVALALPPGTALPEASGILIGQGERDASGVPYASKAFTFSSRKWAHYGTGPVLV
RGSVGRFGEPGALQFDDVELVRVVRDDLARLTGVTAAPVETLVTRWGGGLPQYGTGHLER
VERIEKAVAEVPGLAIAGATLHGVGLPACVATAEAAAQRIAAHLTA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcgtcgcggtcgtcgggggcggcgtttccgggctgaccgcggcgtaccggctc
cggcagctgctcggccccgaagccgagatcacggtgtacgagaagacgacggcgccgggc
gggaagctgcgcaccgccgaactcgccggggtgccctacgacgtcggcgccgaggcgttc
ctcgtccgccgtcccgaaatgctcgcgctggcccgcgagctcgggctcgacgtcgtccac
ccgacgaaggcgcgggcgaagatccacgcgggcggcgccgtcaccgggctgccgcccggc
acggtcatgggcgtgccggcgtcggcggagtcggtggccggggtgctttccgaaaccggc
cggcaggcggtcgaggccgagccgttgctgccggagctgcggctgccgggcggggacgtg
ccgctggggccgctgctgcgcgagcggttcggcgacgaactggtggaccggctggtcgac
ccgctgctcggcggcgtctacgcgggcggggcggacggcctcggcctgcgcgcgaccatg
cccggcctcgcctccgcgctggcggcgggcgcgggctcgctgaccgcggcggccgccgcc
cagctgccggcgaacccgtcgacggcgccggtgttcggcaccgtccctggtggcctcggc
acggtgatcgaccggctcaccacggcgtcgggcgcgcagctgcggaccggcctgccggtg
tgcgagatcgaacggcacggcgacggctggcggctgtgcatcggcgcggcaccgaccgcg
cacgcgccggcggacaacctcgccgaagcggacgcggtcgtgctcgcggtgcccgcgccg
tcggcccgccgcctgctcaccgacctcgtcccggcggcttcggcggccttcggcgaggtc
gaactggcgtcgatggcggtggtcgcgctggcactgccgcccggcaccgcgctgcccgag
gcgtcggggatcctgatcggccagggcgagcgggacgcttcgggcgtgccgtacgcgtcg
aaggcgttcacgttctcgtcgcggaagtgggcccactacggcaccggcccggtcctggtc
cgcggctcggtcggccggttcggcgagccgggcgcgctgcagttcgacgacgtcgagctg
gtccgcgtggtccgcgacgacctcgcccggctgacgggggtgacggcggcgccggtcgag
acgctggtgacgcggtggggcggcgggctgccgcagtacggcaccgggcacctcgagcgg
gtcgagcggatcgagaaggccgtcgcggaggtgccgggcctggcgatcgccggggcgacc
ctgcacggggtcgggctgccggcctgtgtcgcgacggcggaagccgcggcccagcggatc
gcggcgcacctgacggcgtga

DBGET integrated database retrieval system