KEGG   Amycolatopsis mediterranei U32: AMED_2800Help
Entry
AMED_2800         CDS       T01269                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00010  Glycolysis / Gluconeogenesis
amd00051  Fructose and mannose metabolism
amd00562  Inositol phosphate metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01200  Carbon metabolism
amd01230  Biosynthesis of amino acids
Module
amd_M00002  Glycolysis, core module involving three-carbon compounds
amd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_2800 (tpiA)
   00051 Fructose and mannose metabolism
    AMED_2800 (tpiA)
   00562 Inositol phosphate metabolism
    AMED_2800 (tpiA)
Enzymes [BR:amd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AMED_2800 (tpiA)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AMED_2800 (tpiA)
  Exosomal proteins of bladder cancer cells
   AMED_2800 (tpiA)
  Exosomal proteins of melanoma cells
   AMED_2800 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 9437005
NCBI-ProteinID: YP_003764997
UniProt: A0A0H3D1S1
Position
2991514..2992299
Genome map
AA seq 261 aa AA seqDB search
MARKPFIAGNWKMNQNHLEAIALVQKIAFALPEKYYAKVDVAVLPPFTDIRSVQTLVDGD
KLSLTYGAQDVAPQDSGAYTGDISGLMLAKLGCKFVTVGHSERREYHAESDELVNKKVKA
ALKHGITPILCIGEKLEVREAGEHIHHTTTQLIEGLKGLKAEQVKDVVIAYEPVWAIGTG
KVASSADAEEVCKAIRATLQEKYGDEVASSVRVLYGGSVKSGNISELVGCENIDGALVGG
ASLDGEEFTKLCALAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgcaagccgttcatcgccggcaactggaagatgaaccagaaccacctcgaggcg
atcgcgctggtgcagaagatcgccttcgcgctgccggagaagtactacgcgaaggtcgac
gtggcggtgctgccgccgttcaccgacatccgcagcgtgcagaccctggtcgacggcgac
aagctgtcgctcacctacggcgcgcaggacgtcgcgccgcaggattccggcgcctacacc
ggtgacatttcgggcctgatgctggccaagctgggctgcaagttcgtcacggtcgggcac
tcggagcggcgcgaataccacgccgagtccgacgagctggtcaacaagaaggtcaaggcc
gcgctcaagcacggcatcacgccgatcctctgcatcggggagaagctcgaggtccgcgag
gccggcgagcacatccaccacaccacgacgcagctgatcgagggcctgaagggcctcaag
gccgagcaggtcaaagacgtggtgatcgcgtacgagccggtctgggcgatcggcaccggc
aaggtcgcctcgtccgcggacgccgaagaggtctgcaaggccatccgggcgaccctccag
gagaagtacggcgacgaggtggcttcgtccgtccgggtgctctacgggggatcggtgaag
tcgggcaacatcagcgagctggtgggctgcgagaacatcgacggtgccctggtcggcgga
gcgagcctcgacggcgaggagttcacgaaactctgcgcactcgctgcaggcgggccgctg
ccctga

DBGET integrated database retrieval system