KEGG   Amycolatopsis mediterranei U32: AMED_2800Help
Entry
AMED_2800         CDS       T01269                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMED_2800 (tpiA)
   01230 Biosynthesis of amino acids
    AMED_2800 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_2800 (tpiA)
   00051 Fructose and mannose metabolism
    AMED_2800 (tpiA)
   00562 Inositol phosphate metabolism
    AMED_2800 (tpiA)
Enzymes [BR:amd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AMED_2800 (tpiA)
Exosome [BR:amd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AMED_2800 (tpiA)
  Exosomal proteins of bladder cancer cells
   AMED_2800 (tpiA)
  Exosomal proteins of melanoma cells
   AMED_2800 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2991514..2992299
Genome map
AA seq 261 aa AA seqDB search
MARKPFIAGNWKMNQNHLEAIALVQKIAFALPEKYYAKVDVAVLPPFTDIRSVQTLVDGD
KLSLTYGAQDVAPQDSGAYTGDISGLMLAKLGCKFVTVGHSERREYHAESDELVNKKVKA
ALKHGITPILCIGEKLEVREAGEHIHHTTTQLIEGLKGLKAEQVKDVVIAYEPVWAIGTG
KVASSADAEEVCKAIRATLQEKYGDEVASSVRVLYGGSVKSGNISELVGCENIDGALVGG
ASLDGEEFTKLCALAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggcacgcaagccgttcatcgccggcaactggaagatgaaccagaaccacctcgaggcg
atcgcgctggtgcagaagatcgccttcgcgctgccggagaagtactacgcgaaggtcgac
gtggcggtgctgccgccgttcaccgacatccgcagcgtgcagaccctggtcgacggcgac
aagctgtcgctcacctacggcgcgcaggacgtcgcgccgcaggattccggcgcctacacc
ggtgacatttcgggcctgatgctggccaagctgggctgcaagttcgtcacggtcgggcac
tcggagcggcgcgaataccacgccgagtccgacgagctggtcaacaagaaggtcaaggcc
gcgctcaagcacggcatcacgccgatcctctgcatcggggagaagctcgaggtccgcgag
gccggcgagcacatccaccacaccacgacgcagctgatcgagggcctgaagggcctcaag
gccgagcaggtcaaagacgtggtgatcgcgtacgagccggtctgggcgatcggcaccggc
aaggtcgcctcgtccgcggacgccgaagaggtctgcaaggccatccgggcgaccctccag
gagaagtacggcgacgaggtggcttcgtccgtccgggtgctctacgggggatcggtgaag
tcgggcaacatcagcgagctggtgggctgcgagaacatcgacggtgccctggtcggcgga
gcgagcctcgacggcgaggagttcacgaaactctgcgcactcgctgcaggcgggccgctg
ccctga

DBGET integrated database retrieval system