KEGG   Amycolatopsis mediterranei U32: AMED_3130Help
Entry
AMED_3130         CDS       T01269                                 

Gene name
lacZ
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amd00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:amd00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:amd00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3371722..3374760
Genome map
AA seq 1012 aa AA seqDB search
MVLGGVGAAVAASAVTPVARAADALTPPGQARESDFTAGWRFALANPDGVTDPGGRFADA
PKPGFDDSAWQVVDVPHDWSIELPPTGKGTSSGSGFFRGGLGWYRKMFTLPPSPAGKRVS
VEFDGVYSDAHVYLNGELLGHHPYAYTGFAFDLTGRLHTDGRTPNVLAVRATNPLPSSRW
YSGSGIFRRVRLVVTDPVHVARHGTFVTTPDIAAGRGTVRVATDVVNDSGAAVTAQVRTT
VTDPAGRVVATGSTDVAVPAGRTVTAVTGTRVERPLLWSFETPRLYRLRTDVVVAGRVLD
TTTADFGFRYTEFHPDHGFSLNGKPAKLRGVNLHASQGALGAVIDPAALEHQMRLMLAMG
VNALRTAHNPPDPQLVTVCERLGIVMMVEAFDCWRTGKLEYDYHRDFDEWSGRDIAEMVH
AAKNSPAVVLWSIGNEVPDASMAGGPEIAAGLIAAVRAIDPTRPIVMGSDRYRGVPAPGS
PQDLILKQLDGLGVNYNTAQSIDGLHKQYPDKFFFESESSSATSTRGVYQEPELLNTGEN
HTPGKRATSSYDNNLASWTFSGEYSLKKDRDRKFCQGQFLWSGQDYLGEPTPYDVFPVKT
SFFGAIDSAGLPKDAFHLFRSQWTTAPMVHLTPMDWTNHRPGEPVAVRVYSTVDTVELLL
NGKSLGVRKFDRKTTVDGRGYLETTEPAGDDKNDPSGSYTSPNGSAGKLHLTWTVPFEPG
TLTAVARAGGREVARDELVTAGPPRAVELSVDAPGGEVVTGAMTFVTASVVDAHGVVVPG
DGPVLRFTVAGPGRVAGVDNGRQELAQGYQQPAIPAFKGLAVAVVAATGGRGPITVTASA
PGLAPGKLTLPGSSLGQRHGPGARAVETPVVPPASTADASYSGAPDALPSAMLDGNPATG
WSNYYVKPATATLNAVSRPRAADWVSLAWPSAQRISAVTANFVVDAKLALPVAVEVACRT
ARGFEPVRNLRITWGTGSNDPTSFAFDPVVTTEVRVTMTAHGFLRISALLAR
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
gtggtgctgggcggggtcggcgccgctgtcgccgcgtcggccgtcacgccggtcgcccgg
gccgccgacgcgctcacgccgccgggccaggcgcgagaaagcgatttcacggccggctgg
cggttcgccctggccaaccccgacggcgtcaccgatcccggcggtcgcttcgccgacgcc
ccgaagcccggcttcgacgactcggcgtggcaggtggtcgacgtcccgcacgactggagc
atcgaactcccgccgaccggcaagggcaccagcagcgggtccggcttcttccgcggcggg
ctcggctggtaccgcaagatgttcacgctgccgccctcgccggcgggcaagcgcgtgtcg
gtggagttcgacggcgtctattcggacgcccacgtctacctgaacggcgagttgctcggc
caccacccgtacgcctacaccgggttcgccttcgacctcaccggacggctgcacaccgac
ggccggacgccgaacgtcctcgccgtgcgcgcgacgaacccgctgcccagcagccgctgg
tactccggcagcgggatcttccgccgcgtccgcctggtcgtcaccgacccggtgcacgtc
gcccggcacggcacgttcgtcaccacgcccgacatcgccgccggccgcggcacggtgcgg
gtcgccaccgacgtcgtcaacgactccggcgccgcggtcaccgcgcaggtgcgcacgacc
gtcaccgacccggcgggtcgcgtggtggcgaccggctcgacggacgtcgcggtaccggcc
gggcggacggtgacggcggtgaccggaacccgggtcgagcgtcccctgctgtggtcgttc
gagaccccccggctctaccggctgcgcaccgacgtcgtcgtggccgggcgcgtgctcgac
acgaccaccgcggacttcggcttccgctacaccgaattccacccggaccacggattttcg
ctcaacgggaagccggcgaagctgcgcggggtcaacctgcacgcgagccagggtgcgctg
ggcgcggtgatcgacccggctgcgctggagcaccagatgcggctgatgctcgcgatgggc
gtcaacgcgctgcggaccgcgcacaacccgccggacccgcagctggtgacggtctgcgaa
cggctcgggatcgtgatgatggtcgaggcgttcgactgctggcggaccggcaagctcgaa
tacgactaccaccgcgacttcgacgagtggagcgggcgcgacatcgccgaaatggtgcac
gcggccaagaactcgcccgcggtcgtgctctggtcgatcggcaacgaggtgcccgacgcg
tcgatggcgggcggcccggagatcgccgcgggcctgatcgccgcggtccgcgcgatcgac
ccgacccggccgatcgtgatgggttcggaccgctaccgcggtgtgcccgcgccgggctcg
ccgcaggacctcatcctcaagcagctcgacggcctcggcgtcaactacaacaccgcccag
tcgatcgacgggctgcacaagcagtacccggacaagttcttcttcgagtccgagtcgtcg
tcggcgacctcgacgcgcggcgtctaccaggaaccggagctgctcaacaccggcgaaaac
cacacgccgggcaagcgggcgacgtcgtcctacgacaacaacctggcctcgtggaccttc
agcggcgagtactcgctgaagaaggaccgggaccgcaagttctgccagggccagttcctg
tggtccgggcaggactacctcggcgagccgacgccgtacgacgtcttccccgtcaagacg
tccttcttcggcgcgatcgacagcgccggcctgcccaaggacgccttccacctgttccgc
agccagtggaccaccgccccgatggtgcacctgaccccgatggactggacgaaccaccgg
ccgggcgagccagtcgcggtgcgggtctattccactgtggacacggtcgagctgctcctg
aacgggaagtcgttgggcgtgaggaagttcgaccgcaagaccactgtggacggccggggc
tacctggagacgaccgagccggccggcgacgacaagaacgatccctccggcagctacacc
agcccgaacggcagcgccggcaagctgcacctgacctggaccgtgcccttcgagcccggc
acgctgaccgcggtcgcccgggccggcggccgcgaggtggcgcgcgacgaactggtcacg
gccgggccgccgcgcgcggtcgagctgagcgtggacgcgcccggtggcgaggtggtgacc
ggggcgatgacgttcgtgacggcgtcggtcgtggacgcccacggggtcgtcgtgcccggc
gacgggccggtgctgcggttcaccgtcgccgggcccggccgggtcgccggtgtcgacaac
gggcggcaggaactcgcccagggctaccagcagccggcgatcccggcgttcaaggggctg
gccgtcgccgtcgtcgcggcgaccggcgggcgcggcccgatcaccgtgacggcgagtgct
ccggggctggcgccggggaagctcaccctgcccggctcgtccctcggacagcgccacggc
ccgggagcgcgcgcggtcgagaccccggtggtcccgcccgcttcgacggcggacgcgagc
tactcgggcgccccggacgcgctgccgtcggcgatgctggacgggaatccggccaccggc
tggtcgaactactacgtcaaaccggcgacggcgacgctgaacgcggtgagcaggccgcga
gccgcggactgggtgtccctggcctggccgtcagcgcagcggatcagtgccgtcacggcg
aacttcgtcgtggacgcgaagctggcgctgccggtcgccgtcgaagtcgcctgccgcacc
gcccggggcttcgagccggtgcggaacctgcggatcacgtgggggaccggctcgaacgac
ccgacgtcgttcgcattcgatccggtcgtcaccacggaggtgcgggtgacgatgaccgcg
cacggcttcctgcggatcagcgcgctgctggcccgctga

DBGET integrated database retrieval system