KEGG   Amycolatopsis mediterranei U32: AMED_3363Help
Entry
AMED_3363         CDS       T01269                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:amd00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amd00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3630285..3631376)
Genome map
AA seq 363 aa AA seqDB search
MTAPELTRELFGQAGGTDVHRYTLGRPGGPVVRVLDYGGVLQSLEAPDRDGRPGNVVLGY
ADLDAYVANNRPEADRVFLGAVIGRFANRIAGGTFTLDGVQYRVPLNNGKNSLHGGPAGF
DTRIWTAAEIRDGDGVAVQLTLVSPDGDQGYPGRLTAEVTYRLDARDRLRITYRATTDAP
TVVNLTNHTYWNLAGEGAGDVHEHRLEIAASRFCPTGDDLIPAGDPVPVEGTPFDFRRGA
PIGARVGEPDPQLVIGQGYDHNWVLDDGAPFAARAWDPASGRLLTMWTTEPGLQFYSGNY
LTAALTGTGGRPYHRGAGFALEAQHFPDSPNRPDFPSTVLRPGEVYHQETVFALTTADEP
PVA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccgaactcacccgggagttgttcggccaggccggcggcaccgacgtccac
cggtacacgctggggcggcccggcgggccggtcgtgcgcgtgctcgactacggcggcgtg
ctccagtcgctggaggcaccggaccgcgacggccgccccggcaacgtcgtgctcggctac
gcggacctcgacgcctacgtcgccaacaaccggcccgaggcggaccgcgtgttcctcggc
gcggtgatcggccggttcgccaaccggatcgccggcggcaccttcaccctcgacggcgtc
cagtaccgggtgccgctcaacaacggcaagaacagcctgcacggcggcccggccgggttc
gacacgcggatctggacggcggccgaaatccgcgacggcgacggtgtcgcggtgcagctc
acgctggtcagcccggacggcgaccagggctaccccggccggctcaccgccgaggtcacc
taccgcctcgacgcgcgcgaccggctgcgcatcacctaccgcgcgaccaccgatgcgccg
acggtggtcaacctgaccaaccacacctactggaacctggccggcgaaggggcgggcgac
gtccacgagcaccggctggagatcgccgcgagccggttctgcccgaccggcgacgacctg
atcccggccggtgacccggtcccggtcgagggcacgcccttcgacttccgccggggagcg
ccgatcggcgcccgcgtcggcgagcccgacccccagctggtgatcggccagggctacgac
cacaactgggtgctcgacgacggcgcgccgttcgcggcccgcgcgtgggacccggcgtcc
gggcggctgctcaccatgtggacgaccgagccgggcctgcagttctactccggcaactac
ctcaccgcggccctcaccggcaccggcggccgcccgtaccaccgcggcgccggcttcgcg
ctggaggcccagcacttccccgactcccccaaccgcccggacttccccagcacggtgctg
cgccccggcgaggtctaccaccaggagacggtgttcgccctgaccaccgcggacgagccg
ccggtggcgtga

DBGET integrated database retrieval system