KEGG   Amycolatopsis mediterranei U32: AMED_3363Help
Entry
AMED_3363         CDS       T01269                                 

Gene name
galM
Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00010  Glycolysis / Gluconeogenesis
amd00052  Galactose metabolism
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
Module
amd_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_3363 (galM)
   00052 Galactose metabolism
    AMED_3363 (galM)
Enzymes [BR:amd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AMED_3363 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 9437559
NCBI-ProteinID: YP_003765551
UniProt: A0A0H3D2H1
Position
complement(3630285..3631376)
Genome map
AA seq 363 aa AA seqDB search
MTAPELTRELFGQAGGTDVHRYTLGRPGGPVVRVLDYGGVLQSLEAPDRDGRPGNVVLGY
ADLDAYVANNRPEADRVFLGAVIGRFANRIAGGTFTLDGVQYRVPLNNGKNSLHGGPAGF
DTRIWTAAEIRDGDGVAVQLTLVSPDGDQGYPGRLTAEVTYRLDARDRLRITYRATTDAP
TVVNLTNHTYWNLAGEGAGDVHEHRLEIAASRFCPTGDDLIPAGDPVPVEGTPFDFRRGA
PIGARVGEPDPQLVIGQGYDHNWVLDDGAPFAARAWDPASGRLLTMWTTEPGLQFYSGNY
LTAALTGTGGRPYHRGAGFALEAQHFPDSPNRPDFPSTVLRPGEVYHQETVFALTTADEP
PVA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccgaactcacccgggagttgttcggccaggccggcggcaccgacgtccac
cggtacacgctggggcggcccggcgggccggtcgtgcgcgtgctcgactacggcggcgtg
ctccagtcgctggaggcaccggaccgcgacggccgccccggcaacgtcgtgctcggctac
gcggacctcgacgcctacgtcgccaacaaccggcccgaggcggaccgcgtgttcctcggc
gcggtgatcggccggttcgccaaccggatcgccggcggcaccttcaccctcgacggcgtc
cagtaccgggtgccgctcaacaacggcaagaacagcctgcacggcggcccggccgggttc
gacacgcggatctggacggcggccgaaatccgcgacggcgacggtgtcgcggtgcagctc
acgctggtcagcccggacggcgaccagggctaccccggccggctcaccgccgaggtcacc
taccgcctcgacgcgcgcgaccggctgcgcatcacctaccgcgcgaccaccgatgcgccg
acggtggtcaacctgaccaaccacacctactggaacctggccggcgaaggggcgggcgac
gtccacgagcaccggctggagatcgccgcgagccggttctgcccgaccggcgacgacctg
atcccggccggtgacccggtcccggtcgagggcacgcccttcgacttccgccggggagcg
ccgatcggcgcccgcgtcggcgagcccgacccccagctggtgatcggccagggctacgac
cacaactgggtgctcgacgacggcgcgccgttcgcggcccgcgcgtgggacccggcgtcc
gggcggctgctcaccatgtggacgaccgagccgggcctgcagttctactccggcaactac
ctcaccgcggccctcaccggcaccggcggccgcccgtaccaccgcggcgccggcttcgcg
ctggaggcccagcacttccccgactcccccaaccgcccggacttccccagcacggtgctg
cgccccggcgaggtctaccaccaggagacggtgttcgccctgaccaccgcggacgagccg
ccggtggcgtga

DBGET integrated database retrieval system