KEGG   Amycolatopsis mediterranei U32: AMED_3377Help
Entry
AMED_3377         CDS       T01269                                 

Gene name
paaG
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00071  Fatty acid degradation
amd00280  Valine, leucine and isoleucine degradation
amd00281  Geraniol degradation
amd00310  Lysine degradation
amd00360  Phenylalanine metabolism
amd00362  Benzoate degradation
amd00380  Tryptophan metabolism
amd00410  beta-Alanine metabolism
amd00627  Aminobenzoate degradation
amd00640  Propanoate metabolism
amd00650  Butanoate metabolism
amd00903  Limonene and pinene degradation
amd00930  Caprolactam degradation
amd01100  Metabolic pathways
amd01110  Biosynthesis of secondary metabolites
amd01120  Microbial metabolism in diverse environments
amd01130  Biosynthesis of antibiotics
amd01212  Fatty acid metabolism
Module
amd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMED_3377 (paaG)
   00650 Butanoate metabolism
    AMED_3377 (paaG)
  Lipid metabolism
   00071 Fatty acid degradation
    AMED_3377 (paaG)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMED_3377 (paaG)
   00310 Lysine degradation
    AMED_3377 (paaG)
   00360 Phenylalanine metabolism
    AMED_3377 (paaG)
   00380 Tryptophan metabolism
    AMED_3377 (paaG)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMED_3377 (paaG)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMED_3377 (paaG)
   00281 Geraniol degradation
    AMED_3377 (paaG)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMED_3377 (paaG)
   00627 Aminobenzoate degradation
    AMED_3377 (paaG)
   00930 Caprolactam degradation
    AMED_3377 (paaG)
Enzymes [BR:amd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMED_3377 (paaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 9437573
NCBI-ProteinID: YP_003765565
UniProt: A0A0H3D6M6
Position
3653360..3654100
Genome map
AA seq 246 aa AA seqDB search
MGILTKRDGHVEVVTVDFPPVNALPVQAWFDLADAVTQAGRDPDVHVVILRAEGRGFNAG
VDIKEIQRSAGYDALVGANRGCYAAFGAVYDCAVPVIAAVHGFCLGGGIGLVGNADVIIA
SEDATFGVPEVERGALGAATHLARLVPQHLMRTLYFTARKITAAELHTHGSVYRVVPRAD
LDEAALEVARDIAKKDPRVIRAAKEALNGIDTQQVHRSYRFEQGFTFELNLLGASDEARE
EFLNGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggggatcctgaccaagcgcgacggccacgtcgaagtcgtcacggtcgacttcccgccg
gtgaacgcgctgcccgtgcaggcctggttcgacctcgccgacgcggtcacgcaggcgggc
cgggaccccgacgtgcacgtcgtgatcctccgcgcggaaggccgggggttcaacgcgggc
gtggacatcaaggagatccagcgcagcgccggatacgacgccctggtcggcgcgaaccgt
gggtgctacgcggctttcggcgcggtctacgactgcgcggtaccggtgatcgcggcggtg
cacggcttctgcctcggcggcggcatcgggctggtcggcaacgccgacgtgatcatcgct
tccgaagacgccacgttcggcgtgcccgaggtggaacggggggcgctgggcgcggccacg
cacttggcgcggctcgttccgcagcacctgatgcgcacgctgtacttcaccgcccgcaag
atcaccgccgccgagctgcacacccacggttcggtctaccgggtcgtgccgcgcgcggac
ctcgacgaggcggccctcgaagtcgcccgggacatcgcgaagaaggacccgcgggtgatc
cgggcggcgaaagaggccttgaacggcatcgacacccagcaggtgcaccgcagctaccgc
ttcgagcagggcttcaccttcgagctgaacctgctcggcgcgtccgacgaagcccgcgag
gagttcttgaatggccgataa

DBGET integrated database retrieval system