KEGG   Amycolatopsis mediterranei U32: AMED_3421Help
Entry
AMED_3421         CDS       T01269                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMED_3421 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMED_3421 (glk)
   00052 Galactose metabolism
    AMED_3421 (glk)
   00500 Starch and sucrose metabolism
    AMED_3421 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AMED_3421 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AMED_3421 (glk)
   00524 Butirosin and neomycin biosynthesis
    AMED_3421 (glk)
Enzymes [BR:amd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AMED_3421 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3704398..3705288
Genome map
AA seq 296 aa AA seqDB search
MSEDRILGIDFGGTKVALGLADRDGTLLATRRLDTDAHAGAEQVVVRALAAARALLADEG
ASPGCIGVVSPGIVLPDRILLAPNVPGWEQLRLAELVAAEFPAVPISVGTDAKAAALAEW
RWGALAGADPAVFLSLGTGIAAAVLVGGRLLTGANGAAGEIGYNLLSPQDTEGFASGAAP
LEEAVGGRGLGGRASELLGRPVTAGELFALAKENVEAKELVTAALDELSMHVANLAIALD
PERIAVGGGLVRSADVLLPALADRLAHAVPFPPQLVAARFDQDAALLGAVALALGG
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaggatcggattctcgggatcgacttcggcggcacgaaggtggcgctggggctc
gccgatcgcgacggcaccctgctggcgacccgccggctggacaccgacgcgcacgcgggg
gccgagcaggtggtggtgcgcgcgctcgccgcggccagggctctcctggccgacgagggt
gcgtcgcccggctgcatcggcgtcgtcagcccggggatcgtgctgccggaccgcatcctg
ctcgcgccgaacgtgccgggttgggagcagctgcggctggcggagctggtggccgcggag
ttccccgccgtgccgatctcggtgggcacggacgcgaaggcggcggcgctggcggagtgg
cgctggggcgcgctggccggggccgacccggcggtgttcctgtcactgggcaccggcatc
gcggcggcggtgctggtcggcggccggttgctgaccggcgccaacggagctgcgggcgag
atcgggtacaacctgctctcgccgcaggacaccgagggtttcgcgagcggagcggcgccg
ctcgaggaagccgtcggtgggcgtgggctgggcggccgggcgagcgaactgctcggccgc
ccggtcaccgccggggagctgttcgcgctggccaaggaaaacgtcgaggccaaggagctg
gtgacggccgcgctcgacgaactgtcgatgcacgtggccaacctggcgatcgccctggac
ccggagcgcatcgcggtcggcggcggcctggtccggtccgcggacgtgctgctgccggcg
ctggcggaccggctcgcgcacgcggtgccgttcccgccgcagctggtggccgcccgcttc
gaccaggacgcggcgctgctgggcgcggtggcactcgccctgggcggttag

DBGET integrated database retrieval system