KEGG   Amycolatopsis mediterranei U32: AMED_3591Help
Entry
AMED_3591         CDS       T01269                                 

Gene name
cheR
Definition
chemotaxis protein methyltransferase CheR
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:amd02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:amd02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3894474..3895982)
Genome map
AA seq 502 aa AA seqDB search
MRSVTEPQPEDDGEFESVLVYLKESRGFDFTGYKRSSLRRRVQRRMTQAGAGSYAEYIDQ
LQVNADEFVALFNTILINVTGFFRDPEAWEYLRSHAIPALLAERGPTEPIRVWSAGCAAG
QEAYSLAIAFADAIGVDAFRQRVKIYATDVDEEALTQARHAAYTAAEVEGLPEDKLEQYF
ELQGNRYSFRKDLRRSVIFGRNDLVQDAPISRIDLLVCRNTLMYFNAETQTKILERFHFA
LAPRGLMFLGKAEMLLSHSRIFEPLDLKRRVFRKVAGSSAGYSHFASPGPPGRKPIDVSG
LDELREHAFSASPVAQLVVTADEVVALINRQAELSFGLNDRDIGRKLWNLDMSYRPVGLR
PYVEQARLERRSLRVKDVEWRRGSDTVWYEVHVNPLVGRDNSLLGVSVVFHDVSWAHLLL
LELEHTNRRLESAYEELQSTNEELETTNEELQSTVEELETTNEELQSTNEELETMNEELQ
STNDELQTINEPSVTAASNWTS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgcggagcgtgacggagccccagccggaagacgacggtgagttcgagtcggttctcgtg
tacctcaaagagtcgcgaggcttcgacttcaccggctacaagcgcagcagcctgcgacgg
cgggtgcagcgccggatgacccaggccggggccgggagctacgccgagtacatcgaccag
ctccaggtcaacgccgacgagttcgtcgcgctgttcaacaccatcctgatcaacgtcacc
gggttcttccgcgacccggaggcctgggaatacctccgcagccacgcgatcccggcgctg
ctcgccgagcgcggcccgacggagccgatccgcgtgtggagcgccggctgcgccgccggc
caggaggcctacagcctcgccatcgcgttcgccgacgcgatcggcgtcgacgcgttccgg
cagcgcgtcaagatctacgccaccgacgtcgacgaggaagccctcacccaggcccggcac
gcggcctacaccgcggccgaggtcgaagggctgcccgaggacaaactggagcagtacttc
gaactgcagggcaaccggtacagcttccgcaaggacctgcgccggtcggtgatcttcggc
cgcaacgacctcgtccaggacgccccgatctcgcggatcgacctgctcgtgtgccgcaac
acgctgatgtacttcaacgccgagacgcagaccaagatcctcgagcggttccacttcgcg
ctggcgccgcgcgggttgatgttcctgggcaaggccgagatgctgctcagccactcccgc
atcttcgagccgctcgacctcaagcggcgcgtcttccgcaaagtcgccggcagctcggcg
ggctacagccatttcgcctcccccggtcctcccggacggaagccgatcgacgtgtcgggt
ctggacgagctgcgggaacacgccttctccgcaagcccggtggcccagctggtggtgacc
gccgacgaggtggtcgccctgatcaaccggcaggcggagctctcgttcgggctcaacgac
cgcgacatcgggcgcaagctgtggaacctcgacatgtcctaccggccggtcggcctgcgc
ccctacgtggagcaagctcggctggaacggcggtcgctgcgggtgaaggacgtcgagtgg
cggcgcgggagcgacacggtctggtacgaagtgcacgtgaacccgctggtgggccgggac
aacagcctgctcggcgtctcggtggtgttccacgacgtcagctgggcgcacctgctgctg
ctggaactggaacacaccaaccgccggctcgaatccgcctacgaggaactccagtccacg
aacgaagaactcgagaccacgaacgaggagctccagtccactgtggaggaactggagacg
accaacgaagagctccagtccaccaacgaagagctcgaaaccatgaacgaagagctgcag
tcgaccaacgacgagctgcagaccatcaacgagccctccgtgaccgcagcatcgaactgg
acgagctga

DBGET integrated database retrieval system