KEGG   Amycolatopsis mediterranei U32: AMED_3645Help
Entry
AMED_3645         CDS       T01269                                 

Gene name
galA
Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00052  Galactose metabolism
amd00561  Glycerolipid metabolism
amd00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMED_3645 (galA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMED_3645 (galA)
   00600 Sphingolipid metabolism
    AMED_3645 (galA)
Enzymes [BR:amd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AMED_3645 (galA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase_2 NPCBM Melibiase_2_C NPCBM_assoc Melibiase Glyco_hydro_97 Alpha_adaptinC2
Motif
Other DBs
NCBI-GeneID: 9437840
NCBI-ProteinID: YP_003765830
UniProt: A0A0H3D5R0
Position
complement(3953867..3955822)
Genome map
AA seq 651 aa AA seqDB search
MAVAIAACTSVVTVAEAVPAAAAEPGYFAAQRVGERPPMGWNSWNRFGCDINEDLVRGAA
DALVSSGMKDAGYQYINIDDCWAEQNRTAEGKLEPSHERFPHGIKTLADYVHGLGLKLGI
YTSAGTLTCQKTMPGALDHEEADAQSFADWGVDYLKYDNCNNQGRPAIERYTKMGDAIKK
TGRPMIYALCEWGENKPWTWGRDAGAQLWRTTGDISDNWGSMTGILDQQVGLEKFAGPGG
WNDPDMLEVGNGGMTDTEYRSHFALWALLNAPLLAGNDLPAMSPATKAILENNDVIALDQ
DWAGTQGRKLRDDGDTEVWAKPMSDGSAAVVLFNRGSASTTISTTAAELGLEGHTFRVRD
LWTGTETETAGTLRDAVASHDSSVFRVWPSTHPSAAPMTTLALPAPDYVPADRPLTTTLQ
VINDGSTPITQLRATVATPVGWQLDGPGTFTVPAVPPGKSWQQQITFKPVAPGGERVRLA
AKADYSTAWGKRALGSEGTSPLVSRPSSGTTALSKAPWMSSDNGWGPVERGTSNGESQPG
DGHRITIAGVGYDDGIGAHAPSSVRVYVGASCTSVGALVGMDDENAGGSVGFRILGDGKE
LAATGVMHPGDRAQALSAQLTGVQVLELSVTDAGDGNTNDHADWANATITC
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgcgatagccgcctgcacctcggtggtcacggtcgccgaagccgtccccgcc
gcagccgcggagccgggttacttcgctgcccagcgcgtcggcgaacggccgccgatgggc
tggaacagctggaacaggttcggctgcgacatcaacgaggacctcgtccgcggtgccgcc
gacgcactggtgtcgtccggcatgaaggacgcgggctaccagtacatcaacatcgacgac
tgctgggcggaacagaatcgcacggccgagggcaagctcgaacccagccacgaacgcttc
ccacacggcatcaagaccctcgccgactacgtccacgggctcggcctgaagctcggcatc
tacaccagcgccggcacactgacctgccagaagaccatgcccggcgcgctcgaccacgag
gaggcggacgcgcagtccttcgccgattggggcgtcgactatctcaagtacgacaattgc
aacaaccagggtcgaccggcgatcgagcgctacacgaagatgggcgacgcgatcaagaag
accggccgcccgatgatctacgccctctgcgaatggggcgagaacaagccgtggacctgg
gggcgcgacgccggtgcgcagctgtggcgcaccaccggcgacatcagcgacaactggggc
agcatgaccggcatcctcgaccagcaggtcggcctggaaaagttcgcgggccccggcggc
tggaacgacccggacatgctcgaagtcggcaacggcggcatgaccgacaccgagtaccgg
tcgcacttcgcgctgtgggcgctcctgaacgcgccgctgctggccgggaacgacctgccc
gcgatgtcgcccgccaccaaggcgatcctcgagaacaacgacgtcatcgcgctggaccag
gactgggccggcacacagggccgcaagctccgcgacgacggcgacaccgaggtctgggcg
aagccgatgtccgatggatcggccgcggtagtgctcttcaaccgtgggtcggcgagcacg
accatcagcaccacggcggcggaactcggtctcgagggccacaccttccgcgtccgcgac
ctctggaccggcacggaaaccgaaaccgcgggcaccctccgcgacgccgtcgcgtcccac
gactcgtccgtcttccgggtctggccgtcgacgcacccgtcggccgcgccgatgacgacg
ctggccctgccggcgccggactacgtgcccgccgaccgcccgctgaccaccacccttcag
gtcatcaacgacggcagcacgccgatcacccagctccgggccaccgtcgcgacgcccgtc
ggctggcagctcgacggccccggcacgttcacggttccggccgtacccccggggaagtcg
tggcagcagcagatcacgttcaagccggtggcgccgggtggcgagcgcgtcaggctggcg
gccaaagccgactactccaccgcgtggggcaagcgcgccttgggctcggaaggcacgtcg
ccgctcgtctcccgcccgtcgtccggcacgacggcgttgtcaaaggccccgtggatgtcg
tccgacaacggctggggcccggtcgaacgcggcacgagcaacggcgagagccagcctggt
gacggccaccggatcaccatcgccggggtcggctacgacgacggcatcggtgcccacgcc
ccctcgagcgtgcgggtctacgtcggcgcatcctgcacgtccgtcggcgccctggtcggg
atggacgacgagaacgccggtggcagcgtggggttccgcatcctcggtgacggcaaggaa
ctcgccgcgacgggcgtcatgcaccccggagacagggcacaggcgctgtccgcacagctg
accggcgtccaggtgctggaactgtcggtgaccgacgccggcgacggcaacaccaacgat
cacgccgactgggcgaacgccacgatcacctgctga

DBGET integrated database retrieval system