KEGG   Amycolatopsis mediterranei U32: AMED_3750Help
Entry
AMED_3750         CDS       T01269                                 

Gene name
galA
Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00052  Galactose metabolism
amd00561  Glycerolipid metabolism
amd00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AMED_3750 (galA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    AMED_3750 (galA)
   00600 Sphingolipid metabolism
    AMED_3750 (galA)
Enzymes [BR:amd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AMED_3750 (galA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C PilZ Melibiase_2
Motif
Other DBs
NCBI-GeneID: 9437941
NCBI-ProteinID: YP_003765931
UniProt: A0A0H3D7L5
Position
4076803..4078974
Genome map
AA seq 723 aa AA seqDB search
MLTMTFTAGDDKPASPGVVHLGAAGTSLVLDATGDRLPRVVYWGADLGQPTEAELADLVR
AARPPVVSNSIDDPLPVGVLAEAATGWAGTPGIAGSRAGRAFSPLFTKTAVDLTAEGTLI
TTAQDVAAGLALELRVALSPSGVVRLDATVTNIGGDDYGLDSLTLNLPVPANARELLDFT
GRHLRERAPQRHPFTLGSHVRSGRRGRTGLDATLLVLAGEPGFGFRRGEVWGVHTAWSGN
HTTYAERDAAGVAILGGGEILLPGEVILAPGESYACPTLMGSHGDGLDELSGRFHADLRS
RPEHPTSPRPIALNTWEAVYFDHDPAKLRELAVLAARVGAERFTLDDGWFRGRRADNAGL
GDWFVDEQVWPDGLRPIADHVRSLGMQFGLWVEPEMVNPDSDLARAHPEWILRPDGRLPP
EARRQQVLDISRPDAYAYVLDRLDALVTEYGVGYLKWDHNRDLVDAGHTASGTAGVHDQT
RALYRLLDELRAKHPGLEIESCSSGGGRADLEILARTERIWVSDCLDALERQHIQRWTGL
LLPPEMLGSHVGAPTAHTTGRTHTLDFRAGTAFFGHFGMEWDLTSASETELAELTAWIAL
HKRFRPLLHSGTVVRGDHPDPAHWLHGVVAQDRTEALFAFVALQTGASAPPGSVRLPGLA
PGTRYTVRFLSAVERVRRHGLPAFPAWADRPLTLSGAALATAGFQAPALQPEQLQLIHVI
AEH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
gtgttgacgatgacgttcaccgcgggcgacgacaagccggcgagtcccggcgtggtccac
ctcggcgccgccggcaccagcctcgtgctcgacgcaaccggcgaccgcctgcctcgcgtc
gtgtattggggcgccgatctcgggcagcccaccgaagccgaactggcggacctggtgcgc
gcggcccggccaccggtcgtctccaacagcatcgacgacccgctgcccgtcggcgtgctg
gccgaagccgccaccggctgggccggcacccccggcatcgccggcagccgcgccggtcgc
gcgttctccccgctgttcacgaagaccgcggtggacctgacggcggagggcaccctgatc
accaccgcgcaggacgtcgccgccggactggcgctcgagctgcgggtggcgctctcgccg
tcgggtgtggtgcggctggacgcgacggtgacgaacatcggcggcgacgactacggcctc
gactcgctgaccctcaacctgccggtcccggcgaacgcccgggaactgctggatttcacc
ggacgccacctgcgcgagcgcgccccgcagcggcacccgttcacgctgggctcccacgtc
cgcagcggacgccgtggccggaccggcctcgacgcgaccctgctggtgctcgccggtgag
cccggcttcggcttccgccgcggggaggtctggggcgtgcacaccgcctggagcggcaac
cacaccacctacgccgagcgcgacgccgcgggcgtcgcgatcctcggcggcggggaaatc
ctgttgcccggcgaggtgatcctcgccccgggcgagtcctatgcctgcccgacgctgatg
ggttcccacggcgacgggctggacgagctgtccggccggttccacgccgacctgcgcagc
cggcccgagcatcccacctcgccgcggccgatcgccctgaacacctgggaagcggtctac
ttcgaccacgatccggcgaaactgcgcgagctcgccgtgctcgccgcgcgggtcggcgcg
gagcggttcacgctcgacgacggctggttccgcggccgccgggccgacaacgcgggactg
ggtgactggttcgtcgacgagcaggtgtggccggacggtctgcgcccgatcgccgaccac
gtccgctcgctcggcatgcagttcgggctctgggtcgaacccgaaatggtcaacccggac
tccgacctcgcccgggcccacccggagtggatcctccggccggacgggcggctcccgccc
gaggcgcgacgccagcaggtgctcgacatttcccgtccggacgcctacgcctacgtgctg
gaccggctcgacgcgctggtcaccgagtacggcgtcggctacctcaagtgggaccacaac
cgcgatctcgtcgacgcggggcacaccgcgagcggcacggccggcgtgcacgaccagacc
cgcgccctctaccggctgctggacgagctccgcgcgaagcacccgggcctggagatcgag
tcctgctcgtcgggcggtggccgcgccgacctcgagatcctcgcccggaccgagcggatc
tgggtcagcgattgcctggacgcgctcgagcggcagcacatccagcgctggaccgggttg
ctgctgcccccggagatgctgggctcgcacgtcggcgcgccgacggcgcacaccaccggc
cgcacgcacaccctcgacttccgcgccggcaccgcgttcttcgggcacttcggcatggag
tgggacctgacctcggcgagcgaaaccgaactcgccgaactcacggcctggatcgccctg
cacaagcggttccggccgctgctgcacagcggcaccgtcgtccgcggcgaccaccccgac
ccggcgcactggctccacggcgtcgtcgcccaggaccgcaccgaagcgctcttcgccttc
gtcgcgctgcagaccggcgcctcggccccgcccgggagcgtccggctgcccggactggcc
cccggaacccgctacaccgtgcggttcctgtccgccgtcgagcgggtgcgccggcacggg
ctgcccgcgtttcccgcttgggcggaccggccgctgacgttgtcgggcgccgcgctggcc
acggccgggttccaggcgcccgcgttgcagccggaacagctgcagctgatccacgtgatc
gccgagcactga

DBGET integrated database retrieval system