KEGG   Amycolatopsis mediterranei U32: AMED_3880Help
Entry
AMED_3880         CDS       T01269                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4211533..4212450
Genome map
AA seq 305 aa AA seqDB search
MSAFEVPAAGRTLRLGERPWLMGVVNASPESFSDGAQVGTADAQLAHAARLLAEGADIID
VGGESAITNREPLPVTAEIDRVVPVIERITRELGALVSVDTYKPAVAEAAVAAGAVLVND
VSGLRDPALADVCAKTGAALVLMHTRAAPKQRLQDAGLYQDVTQDVLGFLADRMRAAMER
GVPREALILDPGPDFAKTPSQTIEVLRRLPDLHALGRPLLMAVSRKDFIGALTGGRPNQR
LAGTLAAIGYCVDGGGHILRVHDVGAVREYLTVRAALRGELAVDPGVTLDESLRHERPNA
GAPAE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccttcgaggtccccgccgccggccggacgctgcggctgggcgagcgcccgtgg
ctgatgggcgtcgtcaacgcctcgcccgagtcgttctccgacggtgcgcaggtcggcacc
gccgacgcccagctcgcccacgcggcccggctgctcgccgagggcgccgacatcatcgac
gtcggcggcgagtccgcgatcaccaaccgggagccactgccggtcacggcggagatcgac
cgcgtcgtgccggtgatcgagcggatcacccgcgaactcggggccctggtttcggtggac
acctacaagcccgcggtcgcggaagcggctgtcgcggccggtgcggtcctggtcaacgac
gtcagcgggctgcgcgatccggcgttggccgacgtctgcgcgaagaccggcgccgcgctc
gtgctcatgcacacccgggccgcaccgaaacagcggctgcaggacgccgggctctaccag
gacgtcacccaggacgtcctcggcttcctggccgaccggatgcgcgcggccatggagcga
ggcgtgccccgcgaggcgctgatcctcgatcccggcccggacttcgccaagaccccgagc
cagaccatcgaggtcctccggcgcctgcccgacctgcacgcactcggccggccactcctg
atggcggtctcccgcaaggacttcatcggagcgctcaccggcggccggccgaaccagcgg
ctggcgggaacgctggccgccatcggctactgcgtggacgggggcgggcacatcctgcgc
gtgcacgacgtcggtgcggtccgcgagtacctgaccgtgcgcgccgccctccgcggtgag
ctcgccgtggacccgggcgtgaccctcgacgaatcgctccgccacgaacgcccgaacgcg
ggtgcgccggccgaatag

DBGET integrated database retrieval system